Free Bitcoin Miner Pro - Earn BTC 1.0.3 Apk (Android 4.0.x

Free Google Play Credit

Free Google Play Credit GET FREE Google Play money Choose Gift card get Free Google play credit Your free Google play code is ready to generate. Get it now and discover all the possibilities in the play store. Normally you have to pay for the best apps in the store, but this great tool allows you to generate free Google play money! Follow these simple steps to your free Google play credit now.
[link]

Earn Or Mine FREE Bitcoin [BTC] 2017/2018 With Apk App SlideCoin

Earn Or Mine FREE Bitcoin [BTC] 2017/2018 With Apk App SlideCoin submitted by BitcoinAllBot to BitcoinAll [link] [comments]

12-19 20:03 - 'Earn Or Mine FREE Bitcoin [BTC] 2017/2018 With Apk App – SlideCoin' (techgeegs.com) by /u/Gizzhy removed from /r/Bitcoin within 11-21min

Earn Or Mine FREE Bitcoin [BTC] 2017/2018 With Apk App – SlideCoin
Go1dfish undelete link
unreddit undelete link
Author: Gizzhy
submitted by removalbot to removalbot [link] [comments]

Google Alternatives huge list restore your privacy

This guide aims to be the most exhaustive resource available for documenting alternatives to Google products.
With growing concerns over online privacy and securing personal data, more people than ever are considering alternatives to Google products.
After all, Google’s business model essentially revolves around data collection and advertisements, both of which infringe on your privacy. More data means better (targeted) ads and more revenue. The company pulled in over $116 billion in ad revenue last year alone – and that number continues to grow.
But the word is getting out. A growing number of people are seeking alternatives to Google products that respect their privacy and data.
So let’s get started.
Note: The lists below are not necessarily in rank order. Choose the best products and services based on your own unique needs.

Google search alternatives

When it comes to privacy, using Google search is not a good idea. When you use their search engine, Google is recording your IP address, search terms, user agent, and often a unique identifier, which is stored in cookies.
Here are ten alternatives to Google search:
  1. Searx – A privacy-friendly and versatile metasearch engine that’s also open source.
  2. MetaGer – An open source metasearch engine with good features, based in Germany.
  3. SwissCows – A zero-tracking private search engine based in Switzerland, hosted on secure Swiss infrastructure.
  4. Qwant – A private search engine based in France.
  5. DuckDuckGo – A private search engine based in the US.
  6. Mojeek – The only true search engine (rather than metasearch engine) that has its own crawler and index (based in the UK).
  7. YaCy – A decentralized, open source, peer-to-peer search engine.
  8. Givero – Based in Denmark, Givero offers more privacy than Google and combines search with charitable donations.
  9. Ecosia – Ecosia is based in Germany and donates a part of revenues to planting trees.
*Note: With the exception of Mojeek, all of the private search engines above are technically metasearch engines, since they source their results from other search engines, such as Bing and Google.
(Startpage is no longer recommended.)

Gmail alternatives

Gmail may be convenient and popular, but there are three major problems:
  1. Your inbox is used as a data collection tool. (Did you know Google is tracking your purchasing history from the receipts in your inbox?)
  2. Rather than seeing just emails, your email inbox is also used for ads and marketing.
  3. The contents of your inbox are being shared with Google and other random third parties.
When you remain logged in to your Gmail account, Google can easily track your activities online as you browse different websites, which may be hosting Google Analytics or Google ads (Adsense).
Here are ten alternatives to Gmail that do well in terms of privacy:
  1. Tutanota – based in Germany; very secure and private; free accounts up to 1 GB
  2. Mailfence – based in Belgium; lots of features; free accounts up to 500 MB
  3. Posteo – based in Germany; €1/mo with 14 day refund window
  4. StartMail – based in Netherlands; $5.00/mo with 7 day free trial
  5. Runbox – based in Norway; lots of storage and features; $1.66/mo with 30 day free trial
  6. Mailbox.org – based in Germany; €1/mo with 30 day free trial
  7. CounterMail – based in Sweden; $4.00/mo with 7 day free trial
  8. Kolab Now – based in Switzerland; €4.41/mo with 30 day money-back guarantee
  9. ProtonMail – based in Switzerland; free accounts up to 500 MB
  10. Thexyz – based in Canada; $1.95/mo with 30 day refund window

Chrome alternatives

Google Chrome is a popular browser, but it’s also a data collection tool – and many people are taking notice. Just a few days ago, the Washington Post asserted that “Google’s web browser has become spy software,” with 11,000 tracker cookies observed in a single week.
Here are seven alternatives for more privacy:
  1. Firefox browser – Firefox is a very customizable, open-source browser that is popular in privacy circles. There are also many different Firefox modifications and tweaks that will give you more privacy and security. (Also check out Firefox Focus, a privacy-focused version for mobile users.)
  2. Iridium – Based on open source Chromium, Iridium offers numerous privacy and security enhancements over Chrome, source code here.
  3. GNU IceCat – A fork of Firefox from the Free Software Foundation.
  4. Tor browser – A hardened and secured version of Firefox that runs on the Tor network by default. (It also does a good job against browser fingerprinting.)
  5. Ungoogled Chromium – Just as the name says, this is an open source version of Chromium that has been “ungoogled” and modified for more privacy.
  6. Brave – Brave is another Chromium-based browser that is rather popular. It blocks trackers and ads by default (except for “approved” ads that are part of the “Brave Ads” network).
  7. Waterfox – This is a fork of Firefox that is configured for more privacy by default, with Mozilla telemetry stripped out of the code.
Of course, there are other alternatives to Chrome, such as Safari (from Apple), Microsoft Internet ExploreEdge, Opera, and Vivaldi – but these also come with some privacy drawbacks.

Google Drive alternatives

If you’re looking for a secure cloud storage option, you can check out these Google Drive alternatives:
  1. Tresorit – A user-friendly cloud storage option based in Switzerland.
  2. ownCloud – An open source and self-hosted cloud platform developed in Germany.
  3. Nextcloud – Nextcloud is also an open source, self-hosted file sharing and collaboration platform, based in Germany.
  4. Sync – Based in Canada, Sync offers a secure, encrypted cloud storage solution for businesses and individuals.
  5. Syncthing – Here we have a decentralized, open source, peer-to-peer cloud storage platform.
Of course, Dropbox is another popular Google drive alternative, but it’s not the best in terms of privacy.

Google Calendar alternative

Here are some Google Calendar alternatives:
  1. Lightning Calendar is an open source calendar option developed by Mozilla, and it’s compatible with Thunderbird and Seamonkey.
  2. Etar, an open source, basic calendar option.
  3. Fruux, an open source calendar with good features and support for many operating systems.
For those wanting a combined solution for both email and calendar functionality, these providers offer that:

Google Docs / Sheets / Slides alternative

There are many solid Google Docs alternatives available. The largest offline document editing suite is, of course, Microsoft Office. As most people know, however, Microsoft is not the best company for privacy. Nonetheless, there are a few other good Google Docs alternatives:
  1. CryptPad – CryptPad is a privacy-focused alternative with strong encryption, and it’s free.
  2. Etherpad – A self-hosted collaborative online editor that’s also open source.
  3. Mailfence Documents – From the Mailfence team, this is a secure file sharing, storage, and collaboration tool.
  4. Zoho Docs – This is another good Google Docs alternative with a clean interface and good functionality, although it may not be the best for privacy.
  5. OnlyOffice – OnlyOffice feels a bit more restricted than some of the other options in terms of features.
  6. Cryptee – This is a privacy-focused platform for photo and document storage and editing. It’s open source and based in Estonia.
  7. LibreOffice (offline) – You can use LibreOffice which is free and open source.
  8. Apache OpenOffice (offline) – Another good open source office suite.

Google Photos alternative

Here are a few good Google Photos alternatives:
Shoebox was another alternative, but it closed operations in June 2019.

YouTube alternatives

Unfortunately, YouTube alternatives can really be hit or miss, with most struggling to gain popularity.
  1. Peertube
  2. DTube
  3. Bitchute
  4. invidio.us
  5. Vimeo
  6. Bit.tube
  7. Dailymotion
  8. Hooktube
Tip: Invidio.us is a great Youtube proxy that allows you to watch any Youtube video without logging in, even if the video is somehow restricted. To do this, simply replace [www.youtube.com] with [invidio.us] in the URL you want to view.

Google translate alternative

Here are a few Google translate alternatives I have come across:
  1. DeepL – DeepL is a solid Google Translate alternative that seems to give great results. Like Google Translate, DeepL allows you to post up to 5,000 characters at a time (but the pro version is unlimited). The user interface is good and there is also a built-in dictionary feature.
  2. Linguee – Linguee does not allow you to post large blocks of text like DeepL. However, Linguee will give you very accurate translations for single words or phrases, along with context examples.
  3. dict.cc – This Google Translate alternative seems to do a decent job on single-world lookups, but it also feels a bit outdated.
  4. Swisscows Translate – A good translation service supporting many languages.
If you want to translate blocks of text, check out DeepL. If you want in-depth translations for single words or phrases, then Linguee is a good choice.

Google analytics alternative

For website admins, there are many reasons to use an alternative to Google analytics. Aside from privacy concerns, there are also faster and more user-friendly alternatives that also respect your visitors’ privacy.
  1. Clicky is a great alternative to Google Analytics that truncates and anonymizes visitor IP addresses by default. It is lightweight, user-friendly, and fully compliant with GDPR regulations, while also being certified by Privacy Shield.
  2. Matomo (formerly Piwik) is an open-source analytics platform that respects the privacy of visitors by anonymizing and truncating visitor IP addresses (if enabled by the website admin). It is also certified to respect user privacy.
  3. Fathom Analytics is an open source alternative to Google Analytics that’s available on Github here. It’s minimal, fast, and lightweight.
  4. Get Insights – Another privacy-focused analytics platform, with a full analytics suite. The front-end client is open source and available here.
  5. AT Internet is a France-based analytics provider that is fully GDPR compliant, with all data stored on French servers, and a good track record going back to 1996.
Many websites host Google Analytics because they run Google Adsense campaigns. Without Google Analytics, tracking performance of these campaigns would be difficult. Nonetheless, there are still better options for privacy.

Google Maps alternative

A map alternative for PCs is OpenStreetMap.
A few Google Maps alternatives for mobile devices include:
  1. OsmAnd is a free and open-source mobile maps app for both Android and iOS (based on OpenStreetMap data).
  2. Maps (F Droid) uses OpenStreetMap data (offline).
  3. Maps.Me is another option that is free on both Android and iOS, but there is a fair amount of data collection with this alternative, as explained in their privacy policy.
  4. MapHub is also based on OpenStreeMap data and it does not collect locations or user IP addresses.
Note: Waze is not an “alternative” as it is now owned by Google.

Google Play Store alternative

Currently the best Google Play Store alternative is to use F-Droid and then go through the Yalp store. As explained on the official site, F-Droid is an installable catalog of FOSS (Free and Open Source Software) applications for the Android platform.
After you have installed F-Droid, you can then download the Yalp store APK, which allows you to download apps from the Google Play Store directly as APK files.
📷The Yalp Store is a good alternative to the Google Play Store.
See the F-Droid website or the official GitHub page for more info. Other alternatives to the Google Play Store include:

Google Chrome OS alternative

Want to ditch the Chromebook and Chrome OS? Here are a few alternatives:
  1. Linux – Of course, Linux is arguably the best alternative, being a free, open-source operating system with lots of different flavors. With some adjustments, Linux Ubuntu can be run on Chromebooks.
  2. Tails – Tails is a free, privacy-focused operating system based on Linux that routes all traffic through the Tor network.
  3. QubesOS – Recommended by Snowden, free, and also open source.
Of course, the other two big operating system alternatives are Windows and Apple’s operating system for MacBooks – Mac OS. Windows, particularly Windows 10, is a very bad option for privacy. While slightly better, Apple also collects user data and has partnered with the NSA) for surveillance.

Android alternatives

The biggest alternative to Android is iOS from Apple. But we’ll skip over that for reasons already mentioned. Here are a few Android OS alternatives:
  1. LineageOS – A free and open-source operating system for phones and tablets based on Android.
  2. Ubuntu Touch – A mobile version of the Ubuntu operating system.
  3. Plasma Mobile – An open source, Linux-based operating system with active development.
  4. Sailfish OS – Another open source, Linux-based mobile OS.
  5. Replicant – A fully free Android distribution with an emphasis on freedom, privacy, and security.
  6. /e/ – This is another open source project with a focus on privacy and security.
Purism is also working on a privacy-focused mobile phone called the Librem 5. It is in production, but not yet available (estimated Q3 2019).

Google Hangouts alternatives

Here are some alternatives to Google Hangouts:
  1. Wire – A great all-around secure messenger, video, and chat app, but somewhat limited on the number of people who can chat together in a group conversation via voice or video.
  2. Signal – A good secure messenger platform from Open Whisper Systems.
  3. Telegram – A longtime secure messenger app, formerly based in Russia, now in Dubai.
  4. Riot – A privacy-focused encrypted chat service that is also open source.

Google Domains alternative

Google Domains is a domain registration service. Here are a few alternatives:
  1. Namecheap – I like Namecheap because all domain purchases now come with free WhoisGuard protection for life, which protects your contact information from third parties. Namecheap also accepts Bitcoin and offers domain registration, hosting, email, SSL certs, and a variety of other products.
  2. Njalla – Njalla is a privacy-focused domain registration service based in Nevis. They offer hosting options, too, and also accept cryptocurrency payments.
  3. OrangeWebsite – OrangeWebsite offers anonymous domain registration services and also accepts cryptocurrency payments, based in Iceland.

Other Google alternatives

Here more alternatives for various Google products:
Google forms alternativeJotForm is a free online form builder.
Google Keep alternative – Below are a few different Google Keep alternatives:
Google Fonts alternative – Many websites load Google fonts through Google APIs, but that’s not necessary. One alternative to this is to use Font Squirrel, which has a large selection of both Google and non-Google fonts which are free to download and use.
Google Voice alternativeJMP.chat (both free and paid)
G Suite alternativeZoho is probably the best option
Google Firebase alternativeKuzzle (free and open source)
Google Blogger alternativesWordPress, Medium, and Ghost are all good options.
submitted by giganticcobra to degoogle [link] [comments]

guide to how to restore your privacy huge list

This guide aims to be the most exhaustive resource available for documenting alternatives to Google products.
With growing concerns over online privacy and securing personal data, more people than ever are considering alternatives to Google products.
After all, Google’s business model essentially revolves around data collection and advertisements, both of which infringe on your privacy. More data means better (targeted) ads and more revenue. The company pulled in over $116 billion in ad revenue last year alone – and that number continues to grow.
But the word is getting out. A growing number of people are seeking alternatives to Google products that respect their privacy and data.
So let’s get started.
Note: The lists below are not necessarily in rank order. Choose the best products and services based on your own unique needs.

Google search alternatives

When it comes to privacy, using Google search is not a good idea. When you use their search engine, Google is recording your IP address, search terms, user agent, and often a unique identifier, which is stored in cookies.
Here are ten alternatives to Google search:
  1. Searx – A privacy-friendly and versatile metasearch engine that’s also open source.
  2. MetaGer – An open source metasearch engine with good features, based in Germany.
  3. SwissCows – A zero-tracking private search engine based in Switzerland, hosted on secure Swiss infrastructure.
  4. Qwant – A private search engine based in France.
  5. DuckDuckGo – A private search engine based in the US.
  6. Mojeek – The only true search engine (rather than metasearch engine) that has its own crawler and index (based in the UK).
  7. YaCy – A decentralized, open source, peer-to-peer search engine.
  8. Givero – Based in Denmark, Givero offers more privacy than Google and combines search with charitable donations.
  9. Ecosia – Ecosia is based in Germany and donates a part of revenues to planting trees.
*Note: With the exception of Mojeek, all of the private search engines above are technically metasearch engines, since they source their results from other search engines, such as Bing and Google.
(Startpage is no longer recommended.)

Gmail alternatives

Gmail may be convenient and popular, but there are three major problems:
  1. Your inbox is used as a data collection tool. (Did you know Google is tracking your purchasing history from the receipts in your inbox?)
  2. Rather than seeing just emails, your email inbox is also used for ads and marketing.
  3. The contents of your inbox are being shared with Google and other random third parties.
When you remain logged in to your Gmail account, Google can easily track your activities online as you browse different websites, which may be hosting Google Analytics or Google ads (Adsense).
Here are ten alternatives to Gmail that do well in terms of privacy:
  1. Tutanota – based in Germany; very secure and private; free accounts up to 1 GB
  2. Mailfence – based in Belgium; lots of features; free accounts up to 500 MB
  3. Posteo – based in Germany; €1/mo with 14 day refund window
  4. StartMail – based in Netherlands; $5.00/mo with 7 day free trial
  5. Runbox – based in Norway; lots of storage and features; $1.66/mo with 30 day free trial
  6. Mailbox.org – based in Germany; €1/mo with 30 day free trial
  7. CounterMail – based in Sweden; $4.00/mo with 7 day free trial
  8. Kolab Now – based in Switzerland; €4.41/mo with 30 day money-back guarantee
  9. ProtonMail – based in Switzerland; free accounts up to 500 MB
  10. Thexyz – based in Canada; $1.95/mo with 30 day refund window

Chrome alternatives

Google Chrome is a popular browser, but it’s also a data collection tool – and many people are taking notice. Just a few days ago, the Washington Post asserted that “Google’s web browser has become spy software,” with 11,000 tracker cookies observed in a single week.
Here are seven alternatives for more privacy:
  1. Firefox browser – Firefox is a very customizable, open-source browser that is popular in privacy circles. There are also many different Firefox modifications and tweaks that will give you more privacy and security. (Also check out Firefox Focus, a privacy-focused version for mobile users.)
  2. Iridium – Based on open source Chromium, Iridium offers numerous privacy and security enhancements over Chrome, source code here.
  3. GNU IceCat – A fork of Firefox from the Free Software Foundation.
  4. Tor browser – A hardened and secured version of Firefox that runs on the Tor network by default. (It also does a good job against browser fingerprinting.)
  5. Ungoogled Chromium – Just as the name says, this is an open source version of Chromium that has been “ungoogled” and modified for more privacy.
  6. Brave – Brave is another Chromium-based browser that is rather popular. It blocks trackers and ads by default (except for “approved” ads that are part of the “Brave Ads” network).
  7. Waterfox – This is a fork of Firefox that is configured for more privacy by default, with Mozilla telemetry stripped out of the code.
Of course, there are other alternatives to Chrome, such as Safari (from Apple), Microsoft Internet ExploreEdge, Opera, and Vivaldi – but these also come with some privacy drawbacks.

Google Drive alternatives

If you’re looking for a secure cloud storage option, you can check out these Google Drive alternatives:
  1. Tresorit – A user-friendly cloud storage option based in Switzerland.
  2. ownCloud – An open source and self-hosted cloud platform developed in Germany.
  3. Nextcloud – Nextcloud is also an open source, self-hosted file sharing and collaboration platform, based in Germany.
  4. Sync – Based in Canada, Sync offers a secure, encrypted cloud storage solution for businesses and individuals.
  5. Syncthing – Here we have a decentralized, open source, peer-to-peer cloud storage platform.
Of course, Dropbox is another popular Google drive alternative, but it’s not the best in terms of privacy.

Google Calendar alternative

Here are some Google Calendar alternatives:
  1. Lightning Calendar is an open source calendar option developed by Mozilla, and it’s compatible with Thunderbird and Seamonkey.
  2. Etar, an open source, basic calendar option.
  3. Fruux, an open source calendar with good features and support for many operating systems.
For those wanting a combined solution for both email and calendar functionality, these providers offer that:

Google Docs / Sheets / Slides alternative

There are many solid Google Docs alternatives available. The largest offline document editing suite is, of course, Microsoft Office. As most people know, however, Microsoft is not the best company for privacy. Nonetheless, there are a few other good Google Docs alternatives:
  1. CryptPad – CryptPad is a privacy-focused alternative with strong encryption, and it’s free.
  2. Etherpad – A self-hosted collaborative online editor that’s also open source.
  3. Mailfence Documents – From the Mailfence team, this is a secure file sharing, storage, and collaboration tool.
  4. Zoho Docs – This is another good Google Docs alternative with a clean interface and good functionality, although it may not be the best for privacy.
  5. OnlyOffice – OnlyOffice feels a bit more restricted than some of the other options in terms of features.
  6. Cryptee – This is a privacy-focused platform for photo and document storage and editing. It’s open source and based in Estonia.
  7. LibreOffice (offline) – You can use LibreOffice which is free and open source.
  8. Apache OpenOffice (offline) – Another good open source office suite.

Google Photos alternative

Here are a few good Google Photos alternatives:
Shoebox was another alternative, but it closed operations in June 2019.

YouTube alternatives

Unfortunately, YouTube alternatives can really be hit or miss, with most struggling to gain popularity.
  1. Peertube
  2. DTube
  3. Bitchute
  4. invidio.us
  5. Vimeo
  6. Bit.tube
  7. Dailymotion
  8. Hooktube
Tip: Invidio.us is a great Youtube proxy that allows you to watch any Youtube video without logging in, even if the video is somehow restricted. To do this, simply replace [www.youtube.com] with [invidio.us] in the URL you want to view.

Google translate alternative

Here are a few Google translate alternatives I have come across:
  1. DeepL – DeepL is a solid Google Translate alternative that seems to give great results. Like Google Translate, DeepL allows you to post up to 5,000 characters at a time (but the pro version is unlimited). The user interface is good and there is also a built-in dictionary feature.
  2. Linguee – Linguee does not allow you to post large blocks of text like DeepL. However, Linguee will give you very accurate translations for single words or phrases, along with context examples.
  3. dict.cc – This Google Translate alternative seems to do a decent job on single-world lookups, but it also feels a bit outdated.
  4. Swisscows Translate – A good translation service supporting many languages.
If you want to translate blocks of text, check out DeepL. If you want in-depth translations for single words or phrases, then Linguee is a good choice.

Google analytics alternative

For website admins, there are many reasons to use an alternative to Google analytics. Aside from privacy concerns, there are also faster and more user-friendly alternatives that also respect your visitors’ privacy.
  1. Clicky is a great alternative to Google Analytics that truncates and anonymizes visitor IP addresses by default. It is lightweight, user-friendly, and fully compliant with GDPR regulations, while also being certified by Privacy Shield.
  2. Matomo (formerly Piwik) is an open-source analytics platform that respects the privacy of visitors by anonymizing and truncating visitor IP addresses (if enabled by the website admin). It is also certified to respect user privacy.
  3. Fathom Analytics is an open source alternative to Google Analytics that’s available on Github here. It’s minimal, fast, and lightweight.
  4. Get Insights – Another privacy-focused analytics platform, with a full analytics suite. The front-end client is open source and available here.
  5. AT Internet is a France-based analytics provider that is fully GDPR compliant, with all data stored on French servers, and a good track record going back to 1996.
Many websites host Google Analytics because they run Google Adsense campaigns. Without Google Analytics, tracking performance of these campaigns would be difficult. Nonetheless, there are still better options for privacy.

Google Maps alternative

A map alternative for PCs is OpenStreetMap.
A few Google Maps alternatives for mobile devices include:
  1. OsmAnd is a free and open-source mobile maps app for both Android and iOS (based on OpenStreetMap data).
  2. Maps (F Droid) uses OpenStreetMap data (offline).
  3. Maps.Me is another option that is free on both Android and iOS, but there is a fair amount of data collection with this alternative, as explained in their privacy policy.
  4. MapHub is also based on OpenStreeMap data and it does not collect locations or user IP addresses.
Note: Waze is not an “alternative” as it is now owned by Google.

Google Play Store alternative

Currently the best Google Play Store alternative is to use F-Droid and then go through the Yalp store. As explained on the official site, F-Droid is an installable catalog of FOSS (Free and Open Source Software) applications for the Android platform.
After you have installed F-Droid, you can then download the Yalp store APK, which allows you to download apps from the Google Play Store directly as APK files.
📷The Yalp Store is a good alternative to the Google Play Store.
See the F-Droid website or the official GitHub page for more info. Other alternatives to the Google Play Store include:

Google Chrome OS alternative

Want to ditch the Chromebook and Chrome OS? Here are a few alternatives:
  1. Linux – Of course, Linux is arguably the best alternative, being a free, open-source operating system with lots of different flavors. With some adjustments, Linux Ubuntu can be run on Chromebooks.
  2. Tails – Tails is a free, privacy-focused operating system based on Linux that routes all traffic through the Tor network.
  3. QubesOS – Recommended by Snowden, free, and also open source.
Of course, the other two big operating system alternatives are Windows and Apple’s operating system for MacBooks – Mac OS. Windows, particularly Windows 10, is a very bad option for privacy. While slightly better, Apple also collects user data and has partnered with the NSA) for surveillance.

Android alternatives

The biggest alternative to Android is iOS from Apple. But we’ll skip over that for reasons already mentioned. Here are a few Android OS alternatives:
  1. LineageOS – A free and open-source operating system for phones and tablets based on Android.
  2. Ubuntu Touch – A mobile version of the Ubuntu operating system.
  3. Plasma Mobile – An open source, Linux-based operating system with active development.
  4. Sailfish OS – Another open source, Linux-based mobile OS.
  5. Replicant – A fully free Android distribution with an emphasis on freedom, privacy, and security.
  6. /e/ – This is another open source project with a focus on privacy and security.
Purism is also working on a privacy-focused mobile phone called the Librem 5. It is in production, but not yet available (estimated Q3 2019).

Google Hangouts alternatives

Here are some alternatives to Google Hangouts:
  1. Wire – A great all-around secure messenger, video, and chat app, but somewhat limited on the number of people who can chat together in a group conversation via voice or video.
  2. Signal – A good secure messenger platform from Open Whisper Systems.
  3. Telegram – A longtime secure messenger app, formerly based in Russia, now in Dubai.
  4. Riot – A privacy-focused encrypted chat service that is also open source.

Google Domains alternative

Google Domains is a domain registration service. Here are a few alternatives:
  1. Namecheap – I like Namecheap because all domain purchases now come with free WhoisGuard protection for life, which protects your contact information from third parties. Namecheap also accepts Bitcoin and offers domain registration, hosting, email, SSL certs, and a variety of other products.
  2. Njalla – Njalla is a privacy-focused domain registration service based in Nevis. They offer hosting options, too, and also accept cryptocurrency payments.
  3. OrangeWebsite – OrangeWebsite offers anonymous domain registration services and also accepts cryptocurrency payments, based in Iceland.

Other Google alternatives

Here more alternatives for various Google products:
Google forms alternativeJotForm is a free online form builder.
Google Keep alternative – Below are a few different Google Keep alternatives:
Google Fonts alternative – Many websites load Google fonts through Google APIs, but that’s not necessary. One alternative to this is to use Font Squirrel, which has a large selection of both Google and non-Google fonts which are free to download and use.
Google Voice alternativeJMP.chat (both free and paid)
G Suite alternativeZoho is probably the best option
Google Firebase alternativeKuzzle (free and open source)
Google Blogger alternativesWordPress, Medium, and Ghost are all good options.
submitted by giganticcobra to privacytoolsIO [link] [comments]

[No Root Method] PGSharp.com Modified App - Works up to Android 10

How to get a Free Trial Key?
  1. Go to PGSharp.com
  2. Sign up for the Free Trial
  3. If you get the "Out of Stock" page, you can try again later to see if they provide more keys.
  4. If you are lucky, you will get a checkout page like this Screenshot (PC)
  5. You can fill it out with a fake name and billing address because the key is free.
  6. Create a password.
  7. Keep payment as Bitcoin (remember the key is free for right now).
  8. Complete order.
  9. Wait 10 to 30 minutes then try to sign in https://www.pgsharp.com/manage/clientarea.php
  10. Press/click on your "PGSharp License - Trial" like this Screenshot (PC)
  11. You should get a 30+ Characters key like this Screenshot (PC) and my key is censored
  12. The free trial lasts for 14 days.
How do I get news and updates from PGSharp?
They opened a Telegram https://t.me/pgsharp If you want to use Telegram without using your real phone number to sign up, you can download "textPLUS" to get a custom phone number. You need to add an email address into textPLUS and confirm your email before they can give you the phone number. Enter the phone number into Telegram and wait for Telegram to call you to give you the code to activate your account. Do not enter any real personal information in Telegram and do not allow it to access your contacts because the phone number you get from textPLUS will be shared with other people.
Why do they charge money to use?
>>> Please READ before using <<<
[1] Since this is a MODIFIED POGO APP, you must use a NEW / ALTERNATIVE ACCOUNT !!!
This is a modified app similar to iSpoofeiPogo for iPhone and iPad meaning if this Android modified pogo app gets detected, any accounts signed into this app will become part of the next ban wave. It is not safe to use your main account. Just because this is on Android does not make it low risk. This is new, and I consider this to be medium to high risk. There were a lot of crybabies from the first ban wave for the VMOS spoofing guide. DO NOT USE YOUR MAIN ACCOUNT AND BECOME A CRYBABY !!!
[2] Can only use a PTC (Pokemon Trainer Club) account to sign in and play.
What can you do?
What does not work?
Instructions:
Step 1: Create a PTC (Pokemon Trainer Club) account at https://www.pokemon.com
Step 2: Activate your account with the email confirmation.
Step 3: Uninstall the official Pogo app (Google Play Store version).
If you do not uninstall the pogo app from the Google Play Store, the modified app will fail to install.
Step 4: Go to https://www.pgsharp.com/ and download the APK.
Step 5: Allow unknown apps to install.
Step 6: Install PGSharp's app.
Step 7: Paste your key from your PGSharp account.
Step 8: Enter a birthday that proves you are 18 years old or older.
Step 9: Select PTC account and sign in.
Step 10: You will automatically start in China. You must change your location first before you do anything in the game or else you will be put on a cooldown. You must wait 2 hours before you can teleport to a new area. If you do not wait 2 hours, all Pokemon will run away and you get nothing from spinning Pokestops and Gyms.
If you want to have two pogo apps installed, you can install the one from Samsung:
Frequently Asked Questions:
Is it safe to use my main account?
Why is it not safe to use my main account?
Does it have special features like fast catch and excellent throws?
submitted by TastyBananaPeppers to PoGoAndroidSpoofing [link] [comments]

huge list of google alternatives tutorial for those people who respects their privacy

This guide aims to be the most exhaustive resource available for documenting alternatives to Google products.
With growing concerns over online privacy and securing personal data, more people than ever are considering alternatives to Google products.
After all, Google’s business model essentially revolves around data collection and advertisements, both of which infringe on your privacy. More data means better (targeted) ads and more revenue. The company pulled in over $116 billion in ad revenue last year alone – and that number continues to grow.
But the word is getting out. A growing number of people are seeking alternatives to Google products that respect their privacy and data.
So let’s get started.
Note: The lists below are not necessarily in rank order. Choose the best products and services based on your own unique needs.

Google search alternatives

When it comes to privacy, using Google search is not a good idea. When you use their search engine, Google is recording your IP address, search terms, user agent, and often a unique identifier, which is stored in cookies.
Here are ten alternatives to Google search:
  1. Searx – A privacy-friendly and versatile metasearch engine that’s also open source.
  2. MetaGer – An open source metasearch engine with good features, based in Germany.
  3. SwissCows – A zero-tracking private search engine based in Switzerland, hosted on secure Swiss infrastructure.
  4. Qwant – A private search engine based in France.
  5. DuckDuckGo – A private search engine based in the US.
  6. Mojeek – The only true search engine (rather than metasearch engine) that has its own crawler and index (based in the UK).
  7. YaCy – A decentralized, open source, peer-to-peer search engine.
  8. Givero – Based in Denmark, Givero offers more privacy than Google and combines search with charitable donations.
  9. Ecosia – Ecosia is based in Germany and donates a part of revenues to planting trees.
*Note: With the exception of Mojeek, all of the private search engines above are technically metasearch engines, since they source their results from other search engines, such as Bing and Google.
(Startpage is no longer recommended.)

Gmail alternatives

Gmail may be convenient and popular, but there are three major problems:
  1. Your inbox is used as a data collection tool. (Did you know Google is tracking your purchasing history from the receipts in your inbox?)
  2. Rather than seeing just emails, your email inbox is also used for ads and marketing.
  3. The contents of your inbox are being shared with Google and other random third parties.
When you remain logged in to your Gmail account, Google can easily track your activities online as you browse different websites, which may be hosting Google Analytics or Google ads (Adsense).
Here are ten alternatives to Gmail that do well in terms of privacy:
  1. Tutanota – based in Germany; very secure and private; free accounts up to 1 GB
  2. Mailfence – based in Belgium; lots of features; free accounts up to 500 MB
  3. Posteo – based in Germany; €1/mo with 14 day refund window
  4. StartMail – based in Netherlands; $5.00/mo with 7 day free trial
  5. Runbox – based in Norway; lots of storage and features; $1.66/mo with 30 day free trial
  6. Mailbox.org – based in Germany; €1/mo with 30 day free trial
  7. CounterMail – based in Sweden; $4.00/mo with 7 day free trial
  8. Kolab Now – based in Switzerland; €4.41/mo with 30 day money-back guarantee
  9. ProtonMail – based in Switzerland; free accounts up to 500 MB
  10. Thexyz – based in Canada; $1.95/mo with 30 day refund window

Chrome alternatives

Google Chrome is a popular browser, but it’s also a data collection tool – and many people are taking notice. Just a few days ago, the Washington Post asserted that “Google’s web browser has become spy software,” with 11,000 tracker cookies observed in a single week.
Here are seven alternatives for more privacy:
  1. Firefox browser – Firefox is a very customizable, open-source browser that is popular in privacy circles. There are also many different Firefox modifications and tweaks that will give you more privacy and security. (Also check out Firefox Focus, a privacy-focused version for mobile users.)
  2. Iridium – Based on open source Chromium, Iridium offers numerous privacy and security enhancements over Chrome, source code here.
  3. GNU IceCat – A fork of Firefox from the Free Software Foundation.
  4. Tor browser – A hardened and secured version of Firefox that runs on the Tor network by default. (It also does a good job against browser fingerprinting.)
  5. Ungoogled Chromium – Just as the name says, this is an open source version of Chromium that has been “ungoogled” and modified for more privacy.
  6. Brave – Brave is another Chromium-based browser that is rather popular. It blocks trackers and ads by default (except for “approved” ads that are part of the “Brave Ads” network).
  7. Waterfox – This is a fork of Firefox that is configured for more privacy by default, with Mozilla telemetry stripped out of the code.
Of course, there are other alternatives to Chrome, such as Safari (from Apple), Microsoft Internet ExploreEdge, Opera, and Vivaldi – but these also come with some privacy drawbacks.

Google Drive alternatives

If you’re looking for a secure cloud storage option, you can check out these Google Drive alternatives:
  1. Tresorit – A user-friendly cloud storage option based in Switzerland.
  2. ownCloud – An open source and self-hosted cloud platform developed in Germany.
  3. Nextcloud – Nextcloud is also an open source, self-hosted file sharing and collaboration platform, based in Germany.
  4. Sync – Based in Canada, Sync offers a secure, encrypted cloud storage solution for businesses and individuals.
  5. Syncthing – Here we have a decentralized, open source, peer-to-peer cloud storage platform.
Of course, Dropbox is another popular Google drive alternative, but it’s not the best in terms of privacy.

Google Calendar alternative

Here are some Google Calendar alternatives:
  1. Lightning Calendar is an open source calendar option developed by Mozilla, and it’s compatible with Thunderbird and Seamonkey.
  2. Etar, an open source, basic calendar option.
  3. Fruux, an open source calendar with good features and support for many operating systems.
For those wanting a combined solution for both email and calendar functionality, these providers offer that:

Google Docs / Sheets / Slides alternative

There are many solid Google Docs alternatives available. The largest offline document editing suite is, of course, Microsoft Office. As most people know, however, Microsoft is not the best company for privacy. Nonetheless, there are a few other good Google Docs alternatives:
  1. CryptPad – CryptPad is a privacy-focused alternative with strong encryption, and it’s free.
  2. Etherpad – A self-hosted collaborative online editor that’s also open source.
  3. Mailfence Documents – From the Mailfence team, this is a secure file sharing, storage, and collaboration tool.
  4. Zoho Docs – This is another good Google Docs alternative with a clean interface and good functionality, although it may not be the best for privacy.
  5. OnlyOffice – OnlyOffice feels a bit more restricted than some of the other options in terms of features.
  6. Cryptee – This is a privacy-focused platform for photo and document storage and editing. It’s open source and based in Estonia.
  7. LibreOffice (offline) – You can use LibreOffice which is free and open source.
  8. Apache OpenOffice (offline) – Another good open source office suite.

Google Photos alternative

Here are a few good Google Photos alternatives:
Shoebox was another alternative, but it closed operations in June 2019.

YouTube alternatives

Unfortunately, YouTube alternatives can really be hit or miss, with most struggling to gain popularity.
  1. Peertube
  2. DTube
  3. Bitchute
  4. invidio.us
  5. Vimeo
  6. Bit.tube
  7. Dailymotion
  8. Hooktube
Tip: Invidio.us is a great Youtube proxy that allows you to watch any Youtube video without logging in, even if the video is somehow restricted. To do this, simply replace [www.youtube.com] with [invidio.us] in the URL you want to view.

Google translate alternative

Here are a few Google translate alternatives I have come across:
  1. DeepL – DeepL is a solid Google Translate alternative that seems to give great results. Like Google Translate, DeepL allows you to post up to 5,000 characters at a time (but the pro version is unlimited). The user interface is good and there is also a built-in dictionary feature.
  2. Linguee – Linguee does not allow you to post large blocks of text like DeepL. However, Linguee will give you very accurate translations for single words or phrases, along with context examples.
  3. dict.cc – This Google Translate alternative seems to do a decent job on single-world lookups, but it also feels a bit outdated.
  4. Swisscows Translate – A good translation service supporting many languages.
If you want to translate blocks of text, check out DeepL. If you want in-depth translations for single words or phrases, then Linguee is a good choice.

Google analytics alternative

For website admins, there are many reasons to use an alternative to Google analytics. Aside from privacy concerns, there are also faster and more user-friendly alternatives that also respect your visitors’ privacy.
  1. Clicky is a great alternative to Google Analytics that truncates and anonymizes visitor IP addresses by default. It is lightweight, user-friendly, and fully compliant with GDPR regulations, while also being certified by Privacy Shield.
  2. Matomo (formerly Piwik) is an open-source analytics platform that respects the privacy of visitors by anonymizing and truncating visitor IP addresses (if enabled by the website admin). It is also certified to respect user privacy.
  3. Fathom Analytics is an open source alternative to Google Analytics that’s available on Github here. It’s minimal, fast, and lightweight.
  4. Get Insights – Another privacy-focused analytics platform, with a full analytics suite. The front-end client is open source and available here.
  5. AT Internet is a France-based analytics provider that is fully GDPR compliant, with all data stored on French servers, and a good track record going back to 1996.
Many websites host Google Analytics because they run Google Adsense campaigns. Without Google Analytics, tracking performance of these campaigns would be difficult. Nonetheless, there are still better options for privacy.

Google Maps alternative

A map alternative for PCs is OpenStreetMap.
A few Google Maps alternatives for mobile devices include:
  1. OsmAnd is a free and open-source mobile maps app for both Android and iOS (based on OpenStreetMap data).
  2. Maps (F Droid) uses OpenStreetMap data (offline).
  3. Maps.Me is another option that is free on both Android and iOS, but there is a fair amount of data collection with this alternative, as explained in their privacy policy.
  4. MapHub is also based on OpenStreeMap data and it does not collect locations or user IP addresses.
Note: Waze is not an “alternative” as it is now owned by Google.

Google Play Store alternative

Currently the best Google Play Store alternative is to use F-Droid and then go through the Yalp store. As explained on the official site, F-Droid is an installable catalog of FOSS (Free and Open Source Software) applications for the Android platform.
After you have installed F-Droid, you can then download the Yalp store APK, which allows you to download apps from the Google Play Store directly as APK files.
📷The Yalp Store is a good alternative to the Google Play Store.
See the F-Droid website or the official GitHub page for more info. Other alternatives to the Google Play Store include:

Google Chrome OS alternative

Want to ditch the Chromebook and Chrome OS? Here are a few alternatives:
  1. Linux – Of course, Linux is arguably the best alternative, being a free, open-source operating system with lots of different flavors. With some adjustments, Linux Ubuntu can be run on Chromebooks.
  2. Tails – Tails is a free, privacy-focused operating system based on Linux that routes all traffic through the Tor network.
  3. QubesOS – Recommended by Snowden, free, and also open source.
Of course, the other two big operating system alternatives are Windows and Apple’s operating system for MacBooks – Mac OS. Windows, particularly Windows 10, is a very bad option for privacy. While slightly better, Apple also collects user data and has partnered with the NSA) for surveillance.

Android alternatives

The biggest alternative to Android is iOS from Apple. But we’ll skip over that for reasons already mentioned. Here are a few Android OS alternatives:
  1. LineageOS – A free and open-source operating system for phones and tablets based on Android.
  2. Ubuntu Touch – A mobile version of the Ubuntu operating system.
  3. Plasma Mobile – An open source, Linux-based operating system with active development.
  4. Sailfish OS – Another open source, Linux-based mobile OS.
  5. Replicant – A fully free Android distribution with an emphasis on freedom, privacy, and security.
  6. /e/ – This is another open source project with a focus on privacy and security.
Purism is also working on a privacy-focused mobile phone called the Librem 5. It is in production, but not yet available (estimated Q3 2019).

Google Hangouts alternatives

Here are some alternatives to Google Hangouts:
  1. Wire – A great all-around secure messenger, video, and chat app, but somewhat limited on the number of people who can chat together in a group conversation via voice or video.
  2. Signal – A good secure messenger platform from Open Whisper Systems.
  3. Telegram – A longtime secure messenger app, formerly based in Russia, now in Dubai.
  4. Riot – A privacy-focused encrypted chat service that is also open source.

Google Domains alternative

Google Domains is a domain registration service. Here are a few alternatives:
  1. Namecheap – I like Namecheap because all domain purchases now come with free WhoisGuard protection for life, which protects your contact information from third parties. Namecheap also accepts Bitcoin and offers domain registration, hosting, email, SSL certs, and a variety of other products.
  2. Njalla – Njalla is a privacy-focused domain registration service based in Nevis. They offer hosting options, too, and also accept cryptocurrency payments.
  3. OrangeWebsite – OrangeWebsite offers anonymous domain registration services and also accepts cryptocurrency payments, based in Iceland.

Other Google alternatives

Here more alternatives for various Google products:
Google forms alternativeJotForm is a free online form builder.
Google Keep alternative – Below are a few different Google Keep alternatives:
Google Fonts alternative – Many websites load Google fonts through Google APIs, but that’s not necessary. One alternative to this is to use Font Squirrel, which has a large selection of both Google and non-Google fonts which are free to download and use.
Google Voice alternativeJMP.chat (both free and paid)
G Suite alternativeZoho is probably the best option
Google Firebase alternativeKuzzle (free and open source)
Google Blogger alternativesWordPress, Medium, and Ghost are all good options.
submitted by giganticcobra to Huawei [link] [comments]

Developer-friendly guide to the Google "associated account ban" - advice to an iOS developer thinking about Android (misconceptions and alternatives for developers)

I received a query from an iOS developer thinking about developing for Android - and his concerns about the notorious "associated account ban" practice (by Google).
Since the exchange may be of wider use to new developers thinking about Android, I am providing it here - my reply and the comments others may post here should dispel some of the misconceptions about:
NOTE: I asked for permission from the iOS developer - which he granted - so that I could include his quoted text.
 
 
Hi! I'm a junior iOS developer that was looking into branching into Android. If you don't mind, may I ask you some questions about the associated account ban issue?
If you are just starting out with Android, i.e. this is your first account, you don't have to be concerned about the associated account ban issue.
This only becomes relevant if you have a ban - then this ban is percolated to all the other accounts that Google can get it's hands on - ones which it finds "could be you".
But sometimes it makes mistakes and can ban your friend, who may have opened his Google account from your computer, using your Wifi or from your home using your browser. There are examples of a company account being banned because their developer was banned, and the developer was banned not because of any fault of his, but because a friend of him had been banned some time ago for some previous infraction.
These types of bans are possible to get reversed, but usually take a lot of effort, and usually not through usual channels - what seems to work is posting on medium dot com with a convincing blog post that gets viral, and then sometimes Google will reverse. There are cases of account reinstatements after one year, but often it can be a week to a month.
In any case, this is needless disruption for a developer.
Usually app bans/account bans DO NOT lead to a Google account ban - BUT some developers have expressed fears that this could happen. I can't think of a case like that - I have a vague feeling it may have happened once perhaps but can't be sure.
But it DID definitely happen with Markiplier's YouTube fans - when he asked them to post emojis - and Google mass-banned a bunch of those who responded. Markiplier issued videos trying to get his followers' YouTube accounts restored - many were restored, but many weren't (may have been by now). This case was notable because these followers got their ENTIRE Google accounts - including Google Photos and other such personal stuff also account-banned. Thus was particularly egregious.
The alternative to going viral with blog post is to have legal representation - your lawyer sends them a warning letter - supposedly that also works reasonably well. We don't have too many documented public cases for this - but many commenters on androiddev sub-reddit have said that even just having your lawyer send a letter to Google at [email protected] (even though Google says it doesn't read e-mail sent there) - can get results. Again, I don't know of any particular cases that used this method - so cannot give much more insight on this type of appeal to Google.
 
 
  • Would it be possible to create a new identity separate from my old one? Suppose I buy a new phone and new phone number. Only use my mobile data and a new bank account to pay for stuff. The one thing I am not able to change is my location as I can't move out anytime soon.
Developers have been trying to create new accounts after account bans for many years - at least from what one reads on various forums.
So developers certainly do evade such bans - they seems to suggest using different internet WiFi, different Mac address for computer, different browser (so can't be tracked by cookies) and then using different credit card identity - so for example they may open an account in a relative's name.
But if that relative is your wife - who resides in the same place - you are likely to be associated eventually - and wife could suffer the fate of the husband (and the associated ban wouldn't be removed even after divorce!).
 
 
  • Would not opening a developer account be enough to avoid having my colleagues getting associated banned? I have a housemate that got banned, while I was lucky to not share WiFi with him we still stay in the same location. Not only that I have logged into my personal accounts using the office computer and WiFi. I also roughly believe an ex-colleague there might get banned for his personal app on the Play Store in the future. Is it too late to do anything to migitate any association at this point?
I don't know - we don't have the data to be that specific about whether a previous association between you and another dev (even before you actually created a Google account) would contribute towards yours (or his) associated ban.
If you are very enthusiastic about your Android project - you can proceed without bothering about associated account ban - since it is unlikely to affect 100 percent of developers everytime, you could take the risk. If something does happen, you deal with it.
But if it is low priority for you, and you would rather not endanger yourself, or your friends, you could consider not opening a Google developer account - and simply publishing on F-Droid, or even offering your APK via your website.
It gets trickier if you were planning to show ads or have in-app purchases - for ads there are ad providers other than Google Admob - but often they ask where your app is published on Google Play. But possibly it may not be a requirement - for example they may accept that you are only published on F-Droid - though I don't know how this reduces "developer cred" in the eyes of the advertiser (and if they pay less for advertising on such apps).
For in-app purchases, you could use payment processors like 2Checkout - which would allow you to process payments independent of any association with Google.
2Checkout has wider country coverage, but you could try Square and the other credit card processing companies which focus more for U.S. developers.
Some developers have anecdotally reported on androiddev sub-reddit that they are able to get good revenue for apps hosted on their website, and using third-party payment systems like 2Checkout etc. However, this will still be less than what you would get on Google Play Store (because of it's ubiquity/wide reach).
EDIT: xda-developers also seems to have an app store - though you don't hear much about it on androiddev. But it may be a good alternative to F-Droid (if you don't want to open source your app):
https://www.xda-developers.com/xda-labs/
In addition to accessing the forums, Labs contains an app distribution platform for both hobbyist and professional developers. With support for Alpha, Beta, and Stable release channels, developers get the utmost in control. We also have built-in commerce for devs that want to earn money for their work, and unlike Play, where developers only get 70% of app revenue, XDA lets developers keep 100% through PayPal or Bitcoin payment methods.
 
 
  • Despite all this I still want to develop Android apps and share them with people. Is hosting the apk on my personal site the next best thing besides the Play Store? Are there any other app stores I could try? I know there's F-Droid but I don't plan open-sourcing my apps.
Sorry if the message is too long. I don't see Google fixing this issue anytime soon and am just trying to find a way to publish Android apps despite the bleak situation.
There are other android app stores, but because Google forces manufacturers to include Google Play (as part of the Google suite of apps) - it has so far ensured that Google Play remains the dominant store.
Developers have anecdotally reported that they are able to get good sales on Amazon (not sure how it is these days) - overall volume is lower, but the revenue per user is higher, so the overall revenue is not bad, though still lower than for the version of their app on Google Play Store.
As an example, the Chinese market is hard for non-Chinese developers to get into (because of the certification/documentation requirements) - but even if you do that, there are a number of app stores (4 or 5 of the big ones - none of them are particularly dominant over the other). This is obviously an outcome of the fact that Google exited the China market earlier (a decision they may regret, but it has also affected/led to app store fragmentation). Chinese app stores also often have clone apps - so you may find that there already is a version of your app there - sometimes with different ad provider inserted, and sometimes may even seem very different (I have never tried to install the APK from those stores, but have tried to examine the APK contents and found differences).
So there is a negative to not having Google Play Store dominant - and there is a negative to Google Play Store being dominant as well!
The Chinese market has another emerging player - Huawei - they have had an app store (App Gallery - which ships with every Huawei device as well - and which you can download using an APK as well).
However, it has not gained much traction - the only reason I mention it is that it MAY become interesting in the future, since Huawei (for strategic/survival reasons) may have to invest in their app store at much higher levels now - in order to prepare for a future where they are totally excluded from the U.S. market, and cannot ship their devices with Google suite of apps (including Google Play Store).
Given Huawei is a multi-billion dollar company with big ambitions - their whole company future is dependent on this one thing - and so it makes sense that among all the app store contestants, if there is one which will have added impetus behind it, it will be a Huawei App Store (App Gallery). However, their execution thus far has not been exceptional - App Gallery is still anemic in terms of revenue according to some anecdotal reports by developers on androiddev sub-reddit. However that could change in the future, if Huawei's App Gallery implements even more developer friendly processes (for signup, and for in-app purchasing etc.).
 
 
iOS developer's response:
Thank you very much for the detailed reply! I guess I would choose not to create a new identity and just publish outside the app store. Google's ability to track someone feels like more than what I could handle. Hopefully some kind of government regulation or third party competition would appear to knock some sense into Google in the near future. All the best to you and thanks again for your help!
 
 
Asked for permission to use his quotes:
Sure, no problem. Feel free to quote/rephrase it any way you like. It would definitely be a great help to others who are worried about the issue.
 
 
 
 
FAQ - App Bans and Account Bans
 
 
When does a lifetime account ban occur ?
A Google Play account ban can occur due to an "associated account ban" - when Google thinks you are associated with someone else, and that someone else was awarded a lifetime account ban. That person's ban percolates to his associated accounts - i.e. you.
Thus if you become lifetime account banned by Google - you become a threat to your acquaintances, and to your company (and should not be put in charge of their Google Play account once you are lifetime account banned).
If you are not associated with anyone by Google - then your lifetime account ban will occur usually due to an accumulation of app bans.
A Google Play developer account ban IS a lifetime ban.
 
 
How many app bans are required to achieve a lifetime account ban ?
The conventional wisdom some time ago was that 3 app bans were usually what triggered a lifetime account ban.
But from anecdotal evidence from developers on androiddev, we now know:
  • a lifetime account ban can occur with just a single app ban (usually when you only have 1 app published)
  • a lifetime account ban can occur with your first Alpha app (one dev published his first app as an Alpha app - which Google considers as a published app - this app was banned for some reason - which triggered his lifetime account ban)
  • sometimes a lifetime account ban does not occur even after 3 app bans (happens if you have many apps - and some of them are seen by Google as high quality apps ?)
  • sometimes a lifetime account ban can occur as "one event" - these are based on a cascade of app bans (which happen in quick succession - usually because they all violate some recently introduced rule by Google) - this triggers an immediate lifetime account ban. As far as the developer is concerned, the series of events happens so fast that they seem to occur as one event (and there is no chance for them to stave off this attack).
As with most Google "rules" which suffer from the info asymmetry that makes for a "moral hazard" in Google vs partner dealings (app dev/Adsense/YouTubers):
 
 
Other observations about app bans and account bans
  • just as an app ban means a developer cannot get access to the information about his app (Description and other info he previously entered is now not visible to him), similarly if you are lifetime account banned, you lose access to the account information (which you may now need to mount a defence against Google's action).
  • app bans usually lack enough context for a developer to understand what caused them (this is an often cited observation by devs) - only in the simplest of cases is it clear what the cause was (in such cases Google DOES provlde a screenshot sometimes with the e-mail that makes clear (for example a button that takes user to your Google Play app page is not labelled). However, they will not tell you what to do to fix it - for this particular case, you need to add text "My Apps" or "Our Apps" to the button. So even in the cases where Google does give feedback about an app ban, it is so terse as to be more confusing than informative. Sometimes the app can be banned, but is then reinstated after the story goes viral (but not before) - in the case of FX File Explorer the app was reinstated without change: FX File Explorer removed from the Play Store for “deceptively” advertising…a free theme
  • an app ban is labelled as "Suspended" in your Google Developer Console listing for your app. Sometimes an app can be labelled "Update Suspended" - this means you still have time to fix the problem and upload another APK. However, the amount of time you have to fix this is indeterminate and unspecified - the app could transition from "Update Suspended" to "Suspended" at any time without further notice (i.e. permanent app ban).
  • if an app has been labelled "Removed" it means it is not available to users now. However, it's removal is NOT affecting the standing of your account (i.e. it is not an app ban, and not contributing towards an account ban). However, I am not sure what happens if too many of your apps are "Removed" - does it lower your resistance to an account ban i.e. you become like the vulnerable single app developers mentioned above - vulnerable to an account ban because of a single further app ban ?
  • sometimes an app ban can be reversed - we posted on reddit, and also appealed to the e-mail address in the e-mail we got for the app ban. The app moved from "Suspended" (app ban) to "Removed" (i.e. not affecting account standing).
  • sometimes a lifetime account ban can be reversed - usually after you have posted on medium dot com, and the blog post goes viral. Sometimes the accounts are reinstated after a few days, sometimes weeks, and in one known case after a year!
  • lifetime account bans generally DO NOT lead to a ban on your Google account (i.e. will not affect your Google Photos etc.) - however, there have been cases with YouTube account bans which DID affect ALL the Google account content (including Google Photos):
Markiplier's video asking Google that his followers's services still not restored:
Androiddev post:
 
 
Can a developer remove an app if he fears it's future ban may imperil his account ? (similarities to slave labor)
Google does not provide a way for an app developer to remove his app from Google Play.
A dev can only delete his app from Google Play IF it has been downloaded by zero users.
A dev CAN "unpublish" his app (from Pricing & Distribution section), however the app remains visible to existing users, and users who have paid for the app.
However apps you "unpublish" remain liable to app ban - for example an app that is no longer being updated by a developer can fall out of compliance with new rules which Google introduces each year (for example Google no longer honors it's "old apps will always work on newer android versions" compact - every year now apps have to comply with new targetSdkVersion requirements - which means older apps will break and eventually fall out of compliance at a steady pace).
Devs do occasionally neglect their apps (they may be a hobbyist, a scientists, or simply is swamped by new projects, or the old app may no longer be profitable for them to maintain). However such developers may find that Google is forcing them to update their apps which they have no incentive to update any more.
Google uses the threat of a lifetime account ban to COMPEL these developers to keep updating their apps (even when devs want not to do so).
This is a type of compulsion - reminiscent of slave labor - where work is demanded without promise of compensation, or advantage to the worker.
Essentially a developer once published on Google Play, faces the prospect of lifetime obligation to Google.
This is odd, given that Google has in the past portrayed itself as an intermediary between the developer and the user, and not as the actual seller of the app - if so it seems odd that Google feels responsible for enforcing a relationship between developer and user. Perhaps Google now does act as actual selleprovider of apps - given that it now also collects taxes directly for more territories (?)
Recently there was a comment by a Googler (which was also carried by androidpolice) that unpublishing an app will not expose an app to app ban, but that such apps will eventually be "Removed" (as in our app above - see second link at top - ie Removed apps don't put account standing at risk). The androidpolice artice was based on the comment, while the Google commenter was himself at odds with Google docs and said he will get back with others at Google about the discrepancy:
Here is the original reddit comment that whole androidpolice article is using as source:
 
 
What is an "associated account ban" ?
Google's practice of lifetime bans for android developers - bans which percolate from acquaintance to acquaintance. In all likelihood a wife would face an immediate ban if her husband has already been banned - this association would survive divorce:
An lifetime account ban thus risks making a pariah out of a dev as any potential employer may fear tainting their company account and the accompanying hassle if they hire a tainted developer. Thus the early crimes of a dev could become a lifelong "Scarlet Letter".
 
 
Why is the Google appeal process flawed ?
Android developers, once banned, are banned for life - and the only reliable way to get account reinstated is for developer to blog post on medium dot com and achieve virality. Then somehow Google is convinced that the developer's issue has been vetted (for free by the public!) and often restores the account. Even for restored accounts, developers often report that they never found out what led to the account ban in the first place.
Essentially no human at Google can countermand a Google bot's decision - probably because it is a neural net or uses fuzzy rules to decide - which means it is not explainable in human terms.
Google also uses secrecy argument - they need secrecy about why they did something to avoid being "gamed" - i.e. they are afraid their automated processes, once known would be easily exploited - as a loophole in an automated system could be used repeatedly, possibly without detection by Google. Google uses this secrecy argument for Adsense and it's other services as well - where Google partners can be banned without them knowing exactly why that happened.
This developer has created a whole website to document the misbehavior of Google regarding his AdSense account:
As with most Google "rules" which suffer from the info asymmetry that makes for a "moral hazard" in Google vs partner dealings (app dev/Adsense/YouTubers):
 
 
Can a lifetime account ban (developer) lead to a GENERAL Google account ban (Google Photos etc.) ?
Lifetime account bans generally DO NOT lead to a ban on your Google account (i.e. will not affect your Google Photos etc.) - however, there have been cases with YouTube account bans which DID affect ALL the Google account content (including Google Photos):
Markiplier's video asking Google that his followers's services still not restored:
Androiddev post:
 
 
Threats to hobbyist devs and open source developers
Right now the old advice to new devs to publish early with their test apps, and to do it with abandon is totally the wrong advice now. Generations of android tutorials are hopelessly out of tune with that old advice.
The current conventional wisdom is to publish carefully, and sparingly with apps which can be supported by the new dev.
If dev cannot commit to that, they should not post their hobbyists apps to Google Play. This is sound advice to the new hobbyist dev, and to the budding independent dev - if they value their lifetime cred with Google.
It may surprise you but now even open source app developers are under threat - the other developers who copy and publish with their code are rendering the original app under threat.
 
 
submitted by stereomatch to androiddev [link] [comments]

Groestlcoin 6th Anniversary Release

Introduction

Dear Groestlers, it goes without saying that 2020 has been a difficult time for millions of people worldwide. The groestlcoin team would like to take this opportunity to wish everyone our best to everyone coping with the direct and indirect effects of COVID-19. Let it bring out the best in us all and show that collectively, we can conquer anything.
The centralised banks and our national governments are facing unprecedented times with interest rates worldwide dropping to record lows in places. Rest assured that this can only strengthen the fundamentals of all decentralised cryptocurrencies and the vision that was seeded with Satoshi's Bitcoin whitepaper over 10 years ago. Despite everything that has been thrown at us this year, the show must go on and the team will still progress and advance to continue the momentum that we have developed over the past 6 years.
In addition to this, we'd like to remind you all that this is Groestlcoin's 6th Birthday release! In terms of price there have been some crazy highs and lows over the years (with highs of around $2.60 and lows of $0.000077!), but in terms of value– Groestlcoin just keeps getting more valuable! In these uncertain times, one thing remains clear – Groestlcoin will keep going and keep innovating regardless. On with what has been worked on and completed over the past few months.

UPDATED - Groestlcoin Core 2.18.2

This is a major release of Groestlcoin Core with many protocol level improvements and code optimizations, featuring the technical equivalent of Bitcoin v0.18.2 but with Groestlcoin-specific patches. On a general level, most of what is new is a new 'Groestlcoin-wallet' tool which is now distributed alongside Groestlcoin Core's other executables.
NOTE: The 'Account' API has been removed from this version which was typically used in some tip bots. Please ensure you check the release notes from 2.17.2 for details on replacing this functionality.

How to Upgrade?

Windows
If you are running an older version, shut it down. Wait until it has completely shut down (which might take a few minutes for older versions), then run the installer.
OSX
If you are running an older version, shut it down. Wait until it has completely shut down (which might take a few minutes for older versions), run the dmg and drag Groestlcoin Core to Applications.
Ubuntu
http://groestlcoin.org/forum/index.php?topic=441.0

Other Linux

http://groestlcoin.org/forum/index.php?topic=97.0

Download

Download the Windows Installer (64 bit) here
Download the Windows Installer (32 bit) here
Download the Windows binaries (64 bit) here
Download the Windows binaries (32 bit) here
Download the OSX Installer here
Download the OSX binaries here
Download the Linux binaries (64 bit) here
Download the Linux binaries (32 bit) here
Download the ARM Linux binaries (64 bit) here
Download the ARM Linux binaries (32 bit) here

Source

ALL NEW - Groestlcoin Moonshine iOS/Android Wallet

Built with React Native, Moonshine utilizes Electrum-GRS's JSON-RPC methods to interact with the Groestlcoin network.
GRS Moonshine's intended use is as a hot wallet. Meaning, your keys are only as safe as the device you install this wallet on. As with any hot wallet, please ensure that you keep only a small, responsible amount of Groestlcoin on it at any given time.

Features

Download

iOS
Android

Source

ALL NEW! – HODL GRS Android Wallet

HODL GRS connects directly to the Groestlcoin network using SPV mode and doesn't rely on servers that can be hacked or disabled.
HODL GRS utilizes AES hardware encryption, app sandboxing, and the latest security features to protect users from malware, browser security holes, and even physical theft. Private keys are stored only in the secure enclave of the user's phone, inaccessible to anyone other than the user.
Simplicity and ease-of-use is the core design principle of HODL GRS. A simple recovery phrase (which we call a Backup Recovery Key) is all that is needed to restore the user's wallet if they ever lose or replace their device. HODL GRS is deterministic, which means the user's balance and transaction history can be recovered just from the backup recovery key.

Features

Download

Main Release (Main Net)
Testnet Release

Source

ALL NEW! – GroestlcoinSeed Savior

Groestlcoin Seed Savior is a tool for recovering BIP39 seed phrases.
This tool is meant to help users with recovering a slightly incorrect Groestlcoin mnemonic phrase (AKA backup or seed). You can enter an existing BIP39 mnemonic and get derived addresses in various formats.
To find out if one of the suggested addresses is the right one, you can click on the suggested address to check the address' transaction history on a block explorer.

Features

Live Version (Not Recommended)

https://www.groestlcoin.org/recovery/

Download

https://github.com/Groestlcoin/mnemonic-recovery/archive/master.zip

Source

ALL NEW! – Vanity Search Vanity Address Generator

NOTE: NVidia GPU or any CPU only. AMD graphics cards will not work with this address generator.
VanitySearch is a command-line Segwit-capable vanity Groestlcoin address generator. Add unique flair when you tell people to send Groestlcoin. Alternatively, VanitySearch can be used to generate random addresses offline.
If you're tired of the random, cryptic addresses generated by regular groestlcoin clients, then VanitySearch is the right choice for you to create a more personalized address.
VanitySearch is a groestlcoin address prefix finder. If you want to generate safe private keys, use the -s option to enter your passphrase which will be used for generating a base key as for BIP38 standard (VanitySearch.exe -s "My PassPhrase" FXPref). You can also use VanitySearch.exe -ps "My PassPhrase" which will add a crypto secure seed to your passphrase.
VanitySearch may not compute a good grid size for your GPU, so try different values using -g option in order to get the best performances. If you want to use GPUs and CPUs together, you may have best performances by keeping one CPU core for handling GPU(s)/CPU exchanges (use -t option to set the number of CPU threads).

Features

Usage

https://github.com/Groestlcoin/VanitySearch#usage

Download

Source

ALL NEW! – Groestlcoin EasyVanity 2020

Groestlcoin EasyVanity 2020 is a windows app built from the ground-up and makes it easier than ever before to create your very own bespoke bech32 address(es) when whilst not connected to the internet.
If you're tired of the random, cryptic bech32 addresses generated by regular Groestlcoin clients, then Groestlcoin EasyVanity2020 is the right choice for you to create a more personalised bech32 address. This 2020 version uses the new VanitySearch to generate not only legacy addresses (F prefix) but also Bech32 addresses (grs1 prefix).

Features

Download

Source

Remastered! – Groestlcoin WPF Desktop Wallet (v2.19.0.18)

Groestlcoin WPF is an alternative full node client with optional lightweight 'thin-client' mode based on WPF. Windows Presentation Foundation (WPF) is one of Microsoft's latest approaches to a GUI framework, used with the .NET framework. Its main advantages over the original Groestlcoin client include support for exporting blockchain.dat and including a lite wallet mode.
This wallet was previously deprecated but has been brought back to life with modern standards.

Features

Remastered Improvements

Download

Source

ALL NEW! – BIP39 Key Tool

Groestlcoin BIP39 Key Tool is a GUI interface for generating Groestlcoin public and private keys. It is a standalone tool which can be used offline.

Features

Download

Windows
Linux :
 pip3 install -r requirements.txt python3 bip39\_gui.py 

Source

ALL NEW! – Electrum Personal Server

Groestlcoin Electrum Personal Server aims to make using Electrum Groestlcoin wallet more secure and more private. It makes it easy to connect your Electrum-GRS wallet to your own full node.
It is an implementation of the Electrum-grs server protocol which fulfils the specific need of using the Electrum-grs wallet backed by a full node, but without the heavyweight server backend, for a single user. It allows the user to benefit from all Groestlcoin Core's resource-saving features like pruning, blocks only and disabled txindex. All Electrum-GRS's feature-richness like hardware wallet integration, multi-signature wallets, offline signing, seed recovery phrases, coin control and so on can still be used, but connected only to the user's own full node.
Full node wallets are important in Groestlcoin because they are a big part of what makes the system be trust-less. No longer do people have to trust a financial institution like a bank or PayPal, they can run software on their own computers. If Groestlcoin is digital gold, then a full node wallet is your own personal goldsmith who checks for you that received payments are genuine.
Full node wallets are also important for privacy. Using Electrum-GRS under default configuration requires it to send (hashes of) all your Groestlcoin addresses to some server. That server can then easily spy on your transactions. Full node wallets like Groestlcoin Electrum Personal Server would download the entire blockchain and scan it for the user's own addresses, and therefore don't reveal to anyone else which Groestlcoin addresses they are interested in.
Groestlcoin Electrum Personal Server can also broadcast transactions through Tor which improves privacy by resisting traffic analysis for broadcasted transactions which can link the IP address of the user to the transaction. If enabled this would happen transparently whenever the user simply clicks "Send" on a transaction in Electrum-grs wallet.
Note: Currently Groestlcoin Electrum Personal Server can only accept one connection at a time.

Features

Download

Windows
Linux / OSX (Instructions)

Source

UPDATED – Android Wallet 7.38.1 - Main Net + Test Net

The app allows you to send and receive Groestlcoin on your device using QR codes and URI links.
When using this app, please back up your wallet and email them to yourself! This will save your wallet in a password protected file. Then your coins can be retrieved even if you lose your phone.

Changes

Download

Main Net
Main Net (FDroid)
Test Net

Source

UPDATED – Groestlcoin Sentinel 3.5.06 (Android)

Groestlcoin Sentinel is a great solution for anyone who wants the convenience and utility of a hot wallet for receiving payments directly into their cold storage (or hardware wallets).
Sentinel accepts XPUB's, YPUB'S, ZPUB's and individual Groestlcoin address. Once added you will be able to view balances, view transactions, and (in the case of XPUB's, YPUB's and ZPUB's) deterministically generate addresses for that wallet.
Groestlcoin Sentinel is a fork of Groestlcoin Samourai Wallet with all spending and transaction building code removed.

Changes

Download

Source

UPDATED – P2Pool Test Net

Changes

Download

Pre-Hosted Testnet P2Pool is available via http://testp2pool.groestlcoin.org:21330/static/

Source

submitted by Yokomoko_Saleen to groestlcoin [link] [comments]

INVITE CODE - [CKWXKAMB]

Free mining on the server! https://btc-server-mining.com/downloads/BitcoinServerMining.apk To get the bonus 0.0005 BTC - use my referral code in the Referrals page CKWXKAMB Join me in /mining on Reddit at https://www.reddit.com/mining?utm_medium=android_app&utm_source=share
submitted by Rmess1982 to u/Rmess1982 [link] [comments]

Bitcoin Bounce - Beta Testers Required - Win Bitcoin as you play

Bitcoin Bounce - Beta Testers Required - Win Bitcoin as you play
We are looking for more beta testers for Bitcoin Bounce, a hyper casual game where you can win Bitcoin for free. We created this for people with no Bitcoin experience to get their hands on some for free!
Beta Download
App Store: https://testflight.apple.com/join/azKmnsIm
Google Play: https://play.google.com/apps/testing/com.thndrgames.bitcoinbounce
Android APK: https://appdistribution.firebase.dev/i/q3KR383G
Gameplay
Tap to land your character on the blockchain. Then bounce forward with momentum and continue your bounce streak. The aim is to travel as far as you can and get on the leaderboard. You can collect various powerups that will turbo charge your top score.
How to win Bitcoin
As you bounce along the blockchain, you can collect purple tickets - 'THNDR TICKETS'. These count as entries into the Daily Prize Draw, which occurs everyday at 6pm UTC. The more tickets you collect, the better chance of winning a bigger prize. During the beta, we have set it so that everybody wins!
Bitcoin is paid out directly to players over The Lightning Network. Our aim is to make it as simple as possible to demontrate bitcoin to gamers.

Game Play and Bitcoin Cash Out
Feedback
We especially want your feedback if you are a Bitcoin noob. We would love to hear about your experience receiving your first satoshi!
Please reply with any feedback or questions on this thread. Or you can talk with us directly here:
Discord - https://discord.gg/9jacUTS
Telegram - https://t.me/thndrgames
Thanks!
Jack [thndr.games]
web - https://thndr.games
twitter - https://twitter.com/thndrgames
submitted by thndrgames to IndieGaming [link] [comments]

My installed apps; list mostly of Free and Libre Open Source Android Software

Free and Libre Open Source Software returns power to ordinary, everyday people.
Most of these are available on F-Droid. (Use G-Droid for a better UI and excellent ratings system!)
AdAway 4.2.2 (org.adaway) -- No better Android ad blocker. Root required.
Amaze 3.3.2 (com.amaze.filemanager)
APKExtractor Lite 2.8 (com.tutorialsface.apkextractorlite)
APKMirror 1.2 (taco.apkmirror)
AppOpsX 1.2.5 (com.zzzmode.appopsx) root required
Aria2Android 2.0.6 (com.gianlu.aria2android)
Aria2App 4.3.0-beta2 (com.gianlu.aria2app) -- Both search for and download torrents in one app!
Audio Recorder 3.2.20 (com.github.axet.audiorecorder)
Aurora Store 2.0.5-β (com.dragons.aurora)
BackgroundRestrictor 1.5.0 (com.pavelsikun.runinbackgroundpermissionsetter) root required
Bank Australia 3.6b7 (com.fusion.banking) -- Proprietary. Ethical bank, no Aussie bank has a better app.
Barcode Scanner 4.7.8 (com.google.zxing.client.android)
Bitcoin Wallet 6.35 (de.schildbach.wallet)
BitPay 4.6.2 (com.bitpay.wallet) -- I have this because I couldn't find any Free and Libre Open Source bitcoin cash wallets. Have you heard of any? Please let me know.
BlueWallet 3.7.2 (io.bluewallet.bluewallet)
Briar 1.1.5 (org.briarproject.briar.android)
BusyBox 1.29.2 (ru.meefik.busybox) root required
Calendar 6.3.0 (com.simplemobiletools.calendar.pro)
Call Recorder 3.0.2 (org.skvalex.cr) -- Proprietary. Meets my needs.
Chromium 74.0.3691.0 (org.chromium.chrome)
ClassyShark3xodus 1.0-5 (com.oF2pks.classyshark3xodus) -- Great for finding which apps have trackers and then blocking the trackers with AdAway.
Contacts 6.3.0 (com.simplemobiletools.contacts.pro)
Conversations 2.4.0+fcr (eu.siacs.conversations)
Copy to Clipboard 1.0 (se.johanhil.clipboard)
DAVx⁵ 2.2.3.1-ose (at.bitfire.davdroid)
Draw 4.3.1 (com.simplemobiletools.draw)
Dumbphone Assistant 0.5 (com.github.yeriomin.dumbphoneassistant)
F-Droid 1.6-alpha1 (org.fdroid.fdroid)
FairEmail 1.339 (eu.faircode.email)
FastHub-Libre 4.6.7 (com.fastaccess.github.libre)
Fedilab 1.75.0 (fr.gouv.etalab.mastodon)
Feeder 1.8.8 (com.nononsenseapps.feeder)
Feeel 1.94 (com.enjoyingfoss.feeel)
Fennec F-Droid 63.0.2 (org.mozilla.fennec_fdroid)
File Manager 6.1.2 (com.simplemobiletools.filemanager.pro)
Firefox Klar 6.1.1 (org.mozilla.klar)
FOSS Browser 6.2 (de.baumann.browser)
FreeOTP+ 1.0 (org.liberty.android.freeotpplus)
Frost 2.2.2 (com.pitchedapps.frost)
G-Droid 0.8.0 (org.gdroid.gdroid)
Gallery 6.5.2 (com.simplemobiletools.gallery.pro)
GPSTest 3.2.10 (com.android.gpstest.osmdroid)
Jitsi 0.1.258 (org.jitsi)
KDE Connect 1.10.1 (org.kde.kdeconnect_tp)
Kernel Adiutor 0.9.73.3-fdroid0 (com.nhellfire.kerneladiutor) root required
LibreTorrent 1.9.1 (org.proninyaroslav.libretorrent)
Magisk Manager 7.0.0 (com.topjohnwu.magisk) root required
Manyverse 0.1901.2-beta (se.manyver)
Markor 1.2.0 (net.gsantner.markor)
Messenger Lite 40.0.0.25.156 (com.facebook.mlite)
MuPDF mini 1.14.0 (com.artifex.mupdf.mini.app)
NewPipe 0.15.1 (org.schabi.newpipe)
Nextcloud dev 20190216 (com.nextcloud.android.beta)
Nova Launcher 6.0-beta4 (com.teslacoilsw.launcher) -- Proprietary. I tried a few free and libre open source launchers and thought none of them were as good.
Nova Launcher Prime 2017 (com.teslacoilsw.launcher.prime)
Om 1.0 (com.enjoyingfoss.om)
Open Camera 1.45.1 (net.sourceforge.opencamera)
Open Link With 2.5-floss (com.tasomaniac.openwith.floss)
OpenBeautyFacts 2.9.8 (openfoodfacts.github.scrachx.openbeauty)
OpenFoodFacts 2.9.8 (openfoodfacts.github.scrachx.openfood)
OpenKeychain 5.2 (org.sufficientlysecure.keychain)
OpenVegeMap 0.8.1 (pro.rudloff.openvegemap) -- Vegan!
Orbot 16.0.2-RC-1 (org.torproject.android)
OsmAnd~ 3.1.6 (net.osmand.plus)
Password Store 1.3.2 (com.zeapo.pwdstore)
Pedometer 1.0.5 (org.secuso.privacyfriendlyactivitytracker)
QKSMS 3.6.1 (com.moez.QKSMS)
RealCalc 2.3.1 (uk.co.nickfines.RealCalcPlus)
ReoTwé 2.06 (de.digisocken.reotwe)
SD Maid 4.11.7 (eu.thedarken.sdm) -- Proprietary. Works quite well. Root helpful.
SD Maid Pro 4.3.1 (eu.thedarken.sdm.unlocker)
Simple Keyboard 3.5 (rkr.simplekeyboard.inputmethod) -- There is no better keyboard. After per stops using predictive texting per's grammar, spelling, and language skills all increase.
Slide 6.0.1-3 (me.ccrama.redditslide)
Smart AudioBook Player 4.1.6 (ak.alizandro.smartaudiobookplayer)
Stargate Live Wallpaper 3.07 (com.MjolnirInteractive.SGWallpaper) -- Proprietary. Stargate is a fantastic TV show.
Suntimes 0.10.3 (com.forrestguice.suntimeswidget)
Suntimes Calendars 0.2.0 (com.forrestguice.suntimescalendars)
Telegram 5.3.1 (org.telegram.messenger)
Termux 0.66 (com.termux) root helpful
Tor Browser for Android (Alpha) 60.5.0 (org.torproject.torbrowser_alpha)
Transportr 2.0.5 (de.grobox.liberario)
Vinyl Music Player 0.19.2 (com.poupa.vinylmusicplayer)
WireGuard 0.0.20190215 (com.wireguard.android)
Yalp Store 0.45-legacy (com.github.yeriomin.yalpstore)
Do you have a list mostly of free and libre open source software? Please share your list of excellent apps!
ps. I pre-ordered a Librem 5. I wonder if I'll find it better than my Pixel 2.
Update: my server is offline because i'm not a smart person. Will fix it today. Fixed.
pss. Here's a TitaniumBackup update.zip (to be installed via recovery) with all of the free and libre open source apks.
https://cloud.chickee.net/s/5LYoMFHe5jLFPFj
It's hosted on my home server with very slow upload speed (100KB/s), so please download it only if you really want all the free and libre open source apps and can do other things while patiently downloading.
submitted by nmeal to Android [link] [comments]

Como ganhar dinheiro em 2020?

Como ganhar dinheiro em 2020?

https://preview.redd.it/7xsanx233f241.jpg?width=626&format=pjpg&auto=webp&s=c2d232372cb8fe8b7a53f19fa8195015b8eae673
Com certeza absoluta muita dedicação e serviço é algo fundamental, porém se eu tivesse que apostar em algum ramo ou algo do tipo continuaria exercendo o que faço hoje, trabalho com revenda de produtos digitais, Softwares, e-books, cursos, e uma variedade de outros produtos que você pode vender online.
Há uns dois anos atrás esse era um tipo de trabalho no qual ninguém acreditava, imagine então a 9 anos quando eu iniciei, as pessoas chegavam a rir quando se falava em ganhar dinheiro na internet, porém hoje Vejam Só, praticamente todas as pessoas já conhecem alguém que trabalha na internet e ganha dinheiro com isso e fazem disso a sua fonte de renda principal, até mesmo empresas vem abandonando os seus escritórios e levando os seus trabalhos para as casas de seus funcionários, creio que a tendência a cada dia seja mais direcionada a isso, e daqui a alguns anos grande parte da população Terá algum trabalho na internet que seja um trabalho extra ou não.
Um pouco sobre o que eu faço

https://preview.redd.it/34hzb5b43f241.jpg?width=978&format=pjpg&auto=webp&s=37284181826cbab491de3ad68aee4d5142f34445
Um dos softwares que vendo na internet se chama PCG programa classificados grátis Esse software é uma agregador de sites de classificados grátis ou seja cadastrado no programa Tem mais de 200 sites de classificados grátis onde as pessoas podem anunciar produtos e serviços, se trata de um software de publicidade O que é muito fácil de se vender na internet, ao registrar o software você ganha a possibilidade de revendê-lo e os proprietários do mesmo pagam a você 50% de comissão por cada venda que fizer, se você parar de fazer simples análises vai perceber que nem qualquer pessoa paga 50% de comissão por aí, levando em conta que você não terá nenhum custo referente à entrega de produto, custos com produção e outros quaisquer.
GRANDE VANTAGEM DESSE TIPO DE TRABALHO: a grande vantagem que vejo em realizar esse tipo de trabalho além do já citado é que não teria custo algum a não ser o meu tempo com a divulgação que irei fazer, toda a entrega e gerenciamento é feito por parte dos desenvolvedores Então o que me sobra é Apenas divulgar e receber as minhas comissões logicamente, sem ter nenhum trabalho com Os compradores Ou nem mesmo fazer atendimento pois tudo é feito diretamente no site pelos desenvolvedores, por ter um painel de controle online tenho acesso a tudo, pessoas que visitaram o meu linK, pessoas que fizeram o pedido na minha página, manuais, e se você ainda quer garantir mais as suas vendas sempre que fizer um anúncio na internet pode deixar o seu contato assim Os compradores vão entrar diretamente em contato com você.

Você também pode fazer o Mesmo

https://preview.redd.it/b5s2w1h53f241.jpg?width=811&format=pjpg&auto=webp&s=37c9889ee3cfd9aa5f2d38039a4a9c8c92cafd3b
O sistema que citei acima é apenas um de muitos que existem na internet, Existe uma grande diversidade de sistemas de revenda onde você pode estar se cadastrando e participando, e sinceramente a meu ponto de vista para você ganhar dinheiro com esses temas Basta fazer uma simples análise e verificar se você acha que esse produto é “vendivel” ou não, se você acha que sim basta iniciar suas divulgações e logo vai ver os resultados aparecerem.
Não faça como muitas pessoas apenas se cadastre em um sistema achando que vão ganhar dinheiro da noite para o dia de forma mágica pois isso não existe, posso afirmar com toda a certeza que essa é uma forma mais fácil de se trabalhar pois você faz os seus horários e não tem muito trabalho com gerenciamento de estoque ou outros, porém, com toda a certeza posso afirmar também que exige muita dedicação e esforço mas ao final não vai se arrepender.
Posso até mesmo citar outro sistema semelhante, conhecido como Promotion Site Existe um software utilizado também para fazer marketing que tem o mesmo sistema de revenda onde após adquirir o software você pode participar da revenda, Se não me engano a comissão atual que eles pagam por cada revenda que você fizer é de R$40,00 Não pense que isso é pouco, tenha em mente que você não está gastando nada com isso apenas o seu tempo divulgando o software, e pense também que você pode fazer várias vendas por dia com o passar do tempo e suas divulgações feitas.
No final de tudo se tiver dedicação você vai ter sucesso com certeza e para o ano que vem com certeza esse tipo de trabalho vai estar ainda mais em Foco assim como nos anos seguintes, e faço uma aposta nos sistemas que indiquei Pois a cada dia mais as pessoas vão precisar de divulgar coisas na internet e com isso esses softwares vão vender como água. “em meu ponto de vista”.
Enfim, de coração espero ter ajudado com a minha resposta e que você possa tirar algum proveito da mesma caso pretendem iniciar um trabalho na internet ou não, ficaria muito grato se recebeste um voto positivo de sua parte pela resposta dada “e também de você que está lendo” , fico muito grato, desejo excelentes negócios e um próspero futuro….
Abraços.
Palavras-chave relacionadas:
ganhar dinheiro na internet, ganhar dinheiro online, ganhar dinheiro extra, ganhar dinheiro com app, ganhar dinheiro rapido, ganhar dinheiro no paypal, ganhar dinheiro jogando, ganhar dinheiro com instagram, ganhar dinheiro no youtube, ganhar dinheiro assistindo videos, ganhar dinheiro app, ganhar dinheiro apostando, ganhar dinheiro assistindo futebol, ganhar dinheiro anunciando, ganhar dinheiro apostando em futebol, ganhar dinheiro assistindo propaganda, ganhar dinheiro anunciando produtos, ganhar dinheiro avaliando, a ganhar dinheiro rapido, ganhar a dinheiro, a ganhar muito dinheiro, a como ganhar dinheiro no cartola, quando começa a ganhar dinheiro no youtube, como começar a ganhar dinheiro, a oração para ganhar dinheiro, jogos online a ganhar dinheiro, ganhar dinheiro a curto prazo, ganhar dinheiro a noite, ganhar dinheiro a traduzir textos, ganhar dinheiro a internet, ganhar dinheiro a escrever textos, ganhar dinheiro a juros, ganhar dinheiro a escrever artigos, ganhar dinheiro a rodo, ganhar dinheiro vendendo água, aprenda a ganhar dinheiro, aprenda a ganhar dinheiro na internet, começar a ganhar dinheiro do zero, comece a ganhar dinheiro em 21 dias, comece a ganhar dinheiro agora, começar a ganhar dinheiro, comece a ganhar dinheiro hoje, comece a ganhar dinheiro agora mesmo, ganhar dinheiro de jogo, ganhar dinheiro de sites, ganhar dinheiro bitcoin, ganhar dinheiro bet365, ganhar dinheiro baixando app, ganhar dinheiro blog, ganhar dinheiro brasfoot 2019, ganhar dinheiro bolsa, ganhar dinheiro bolsa de valores, ganhar dinheiro baixando aplicativos, ganhar dinheiro bitcoins, ganhar dinheiro bolsa gta v, plano b para ganhar dinheiro, ganhar dinheiro com pesquisas, ganhar dinheiro com internet, ganhar dinheiro com youtube, ganhar dinheiro com artesanato, ganhar dinheiro com blog, ganhar dinheiro com picpay, sonhar c ganhar dinheiro, ganhar dinheiro c artesanato, ganhar dinheiro com impressora, significado sonhar c ganhar dinheiro, o que significa sonhar com ganhar dinheiro, qual o significado de sonhar ganhando dinheiro, significado de sonhar com ganhar dinheiro, sonhar com ganhar dinheiro, sonhar que ganhar dinheiro, ganhar dinheiro divulgando, ganhar dinheiro de graça, ganhar dinheiro dormindo, ganhar dinheiro de verdade, ganhar dinheiro divulgando noticias, ganhar dinheiro digitando nomes, ganhar dinheiro desempregado, ganhar dinheiro dirigindo, ganhar dinheiro desenhando, de ganhar dinheiro sinonimo, formas de ganhar dinheiro, formas de ganhar dinheiro extra, maneiras de ganhar dinheiro, formas de ganhar dinheiro na internet, maneiras de ganhar dinheiro na internet, maneiras de ganhar dinheiro extra, formas de ganhar dinheiro rapido, app de ganhar dinheiro, aplicativo de ganhar dinheiro, ganhar dinheiro escrevendo, ganhar dinheiro enviando email, ganhar dinheiro em app, ganhar dinheiro extra na internet, ganhar dinheiro escrevendo artigos, ganhar dinheiro em ingles, ganhar dinheiro escutando musica, ganhar dinheiro enquanto dorme, é possivel ganhar dinheiro na internet, responder pesquisas e ganhar dinheiro, responder perguntas e ganhar dinheiro, como investir e ganhar dinheiro, trabalhar online e ganhar dinheiro, como trabalhar e ganhar dinheiro pela internet, como trabalhar e ganhar dinheiro na internet, como criar e ganhar dinheiro com um blog, como criar e ganhar dinheiro com um aplicativo, artesanato para vender e ganhar dinheiro, ganhar dinheiro é dificil, ganhar dinheiro respondendo pesquisas é verdade, ganhar dinheiro com pesquisas é confiavel, ganhar dinheiro na internet é possivel, ganhar dinheiro e cartões oferta grátis, ganhar dinheiro e diamante no free fire, ganhar dinheiro e cartões oferta grátis apk, ganhar dinheiro e premios respondendo pesquisas, ganhar dinheiro e ficar rico enfim, ganhar dinheiro e commerce, ganhar dinheiro e viajar, ganhar dinheiro e investir, jogar e ganhar dinheiro, é possivel ganhar dinheiro no instagram, vender e ganhar dinheiro, opinar e ganhar dinheiro, investir e ganhar dinheiro, é possivel ganhar dinheiro com blog, é possivel ganhar dinheiro com day trade, jogar e ganhar dinheiro de verdade, é possivel ganhar dinheiro com hotmart, ganhar dinheiro facebook, ganhar dinheiro fazendo live, ganhar dinheiro facil na internet, ganhar dinheiro fazendo propaganda, ganhar dinheiro fazendo entregas, ganhar dinheiro fazendo pesquisa, ganhar dinheiro freelancer, ganhar dinheiro forza horizon 4, ganhar dinheiro final de semana, ganhar dinheiro gta v, ganhar dinheiro google, ganhar dinheiro gratis, ganhar dinheiro google play, ganhar dinheiro gta v online, ganhar dinheiro gta v offline, ganhar dinheiro gta v historia, ganhar dinheiro gta, ganhar dinheiro google maps, ganhar dinheiro gta san andreas, g suite ganhar dinheiro, ganhar dinheiro hotmart, ganhar dinheiro hoje, ganhar dinheiro home office, ganhar dinheiro honestamente, ganhar dinheiro hoje agora, ganhar dinheiro horas vagas, ganhar dinheiro hackeando, ganhar dinheiro hj, ganhar dinheiro hoje na internet, ganhar dinheiro hay day, ganhar dinheiro internet, ganhar dinheiro investindo, ganhar dinheiro indicando, ganhar dinheiro instagram, ganhar dinheiro investindo pouco, ganhar dinheiro indicando imóveis, ganhar dinheiro iphone, ganhar dinheiro impressora 3d, ganhar dinheiro inesperado, ganhar dinheiro ideias, ganhar dinheiro com porquinhos da índia, como ganhar dinheiro com porquinho da india, ganhar dinheiro jogando lol, ganhar dinheiro jogando poker, ganhar dinheiro jogando free fire, ganhar dinheiro jogando fortnite, ganhar dinheiro jogando online, ganhar dinheiro jogando fifa, ganhar dinheiro jogando games, ganhar dinheiro jogando no celular, ganhar dinheiro kwai, ganhar dinheiro karate, ganhar dinheiro em ksa, ganhar dinheiro com km de vantagens, ganhar dinheiro com kombi, ganhar dinheiro no kindle, ganhar dinheiro com kefir, ganhar dinheiro com kitnet, ganhar dinheiro com kit festa, ganhar dinheiro mary kay, ganhar dinheiro lendo, ganhar dinheiro lendo emails é verdade, ganhar dinheiro loja virtual, ganhar dinheiro lifeinvader, ganhar dinheiro lendo email, ganhar dinheiro lutando, ganhar dinheiro live, ganhar dinheiro legendado, ganhar dinheiro lol, ganhar dinheiro loteria, l como ganhar dinheiro, ganhar dinheiro mercado pago, ganhar dinheiro mercado livre, ganhar dinheiro minerando, ganhar dinheiro marketing digital, ganhar dinheiro milhas, ganhar dinheiro magazine luiza, ganhar dinheiro mercado financeiro, ganhar dinheiro muito rapido, ganhar dinheiro mixer, ganhar dinheiro medium, ganhar dinheiro no instagram, ganhar dinheiro no picpay, ganhar dinheiro no the sims 4, ganhar dinheiro na play store, ganhar dinheiro n, ganhar dinheiro online na hora, ganhar dinheiro online gratis, ganhar dinheiro ouvindo musica, ganhar dinheiro opinando, ganhar dinheiro online 2019, ganhar dinheiro online app, ganhar dinheiro online agora, ganhar dinheiro online jogando, ganhar dinheiro online paypal, o que fazer para ganhar dinheiro, o que vender para ganhar dinheiro, o que vender para ganhar dinheiro rapido, o que fazer para ganhar dinheiro extra, o que vender para ganhar dinheiro extra, o que vender para ganhar dinheiro com pouco investimento, o que fazer para ganhar dinheiro rápido, o que montar para ganhar dinheiro, o q fazer para ganhar dinheiro, o que abrir para ganhar dinheiro, ganhar dinheiro o natal, o que ganhar dinheiro, o que ganhar dinheiro em 2019, como ganhar dinheiro, ganhar dinheiro pela internet, ganhar dinheiro paypal, ganhar dinheiro picpay, ganhar dinheiro pagando contas, ganhar dinheiro pesquisas, ganhar dinheiro postando videos, ganhar dinheiro programando, ganhar dinheiro por indicação, ganhar dinheiro por dia, para ganhar dinheiro, para ganhar dinheiro extra, para ganhar dinheiro rápido, para ganhar dinheiro no youtube precisa de quantas visualizações, para ganhar dinheiro fácil, para ganhar dinheiro no youtube, para ganhar dinheiro urgente, para ganhar dinheiro simpatias, para ganhar dinheiro jogos, para ganhar dinheiro urgente oração, ganhar dinheiro quinto andar, ganhar dinheiro quinze, ganhar dinheiro quora, ganhar dinheiro questionários, ganhar dinheiro com quinze, ganhar dinheiro quero, ganhar dinheiro respondendo quiz, como ganhar dinheiro quando se é menor, como ganhar dinheiro quando está desempregado, como ganhar dinheiro quando se é jovem, que ganhar dinheiro, aplicativo que ganhar dinheiro, app que ganhar dinheiro, jogos que ganhar dinheiro, tenho que ganhar dinheiro, com que ganhar dinheiro em 2018, ganhar dinheiro respondendo, ganhar dinheiro rapido na internet, ganhar dinheiro revendendo, ganhar dinheiro recebendo email, ganhar dinheiro rappi, ganhar dinheiro respondendo pesquisas google, ganhar dinheiro respondendo email, ganhar dinheiro respondendo pesquisas 2019, ganhar dinheiro sendo menor, ganhar dinheiro steam, ganhar dinheiro sendo afiliado, ganhar dinheiro spotify, ganhar dinheiro sinonimo, ganhar dinheiro site, ganhar dinheiro stardew valley, ganhar dinheiro simpatia, ganhar dinheiro sendo youtuber, ganhar dinheiro sendo cobaia, s para ganhar dinheiro, ganhar dinheiro the sims 4, ganhar dinheiro traduzindo, ganhar dinheiro trabalhando na internet, ganhar dinheiro testando produtos, ganhar dinheiro trabalhando, ganhar dinheiro testando sites, ganhar dinheiro testando jogos, ganhar dinheiro trabalhando pouco, ganhar dinheiro the sims 3, ganhar dinheiro twitch, ganhar dinheiro urgente, ganhar dinheiro usando a internet, ganhar dinheiro uber, ganhar dinheiro usando o celular, ganhar dinheiro uber eats, ganhar dinheiro udemy, ganhar dinheiro usando app, ganhar dinheiro usando o pc, ganhar dinheiro urgente na internet, ganhar dinheiro usando a voz, um ganhar dinheiro, ganhar um dinheiro rapido, ganhar um dinheiro extra com artesanato, ganhar um dinheiro bom, ganhar um dinheiro extra em ingles, ganhar dinheiro vendendo, ganhar dinheiro viajando, ganhar dinheiro vendendo doces, ganhar dinheiro vendo anuncios, ganhar dinheiro vendendo fotos, ganhar dinheiro vendendo na internet, ganhar dinheiro vendo propaganda, ganhar dinheiro vendendo roupas, ganhar dinheiro vendendo laços, gta v ganhar dinheiro, gta v ganhar dinheiro modo historia, gta v ganhar dinheiro na bolsa, gta v ganhar dinheiro online, gta v ganhar dinheiro offline, gta v ganhar dinheiro na bolsa de valores, gta v ganhar dinheiro lester, gta v ganhar dinheiro com ações, gta v ganhar dinheiro depois de zerar, gta v ganhar dinheiro lcn, ganhar dinheiro wish, ganhar dinheiro whatsapp, ganhar dinheiro workana, ganhar dinheiro watch dogs 2, ganhar dinheiro witcher 3, ganhar dinheiro wattpad, ganhar dinheiro waze carpool, ganhar dinheiro wikihow, ganhar dinheiro wordpress, ganhar dinheiro web, ganhar dinheiro youtube, ganhar dinheiro yahoo, ganhar dinheiro yahoo respostas, ganhar dinheiro youtube visualizações, ganhar dinheiro youtube 2018, ganhar dinheiro youtube analytics, ganhar dinheiro no youtube com videos dos outros, ganhar dinheiro zelda breath, ganhar dinheiro zynga poker, ganhar dinheiro na zona rural, como ganhar dinheiro zelda breath of the wild, como ganhar dinheiro zepeto, ganhar dinheiro no zap, ganhar dinheiro pelo zap, como ganhar dinheiro zoo tycoon, como ganhar dinheiro zula, ganhar dinheiro do 0, ganhar dinheiro fifa 07, como ganhar dinheiro cm 01/02, 0 que fazer para ganhar dinheiro, 0 que vender para ganhar dinheiro, oq posso fazer para ganhar dinheiro, o q posso fazer para ganhar dinheiro, ganhar dinheiro 188bet, ganhar dinheiro 18 anos, ganhar dinheiro fifa 19, ganhar dinheiro com 100 reais, ganhar dinheiro em 1 dia, ganhar dinheiro com 1000 reais, como ganhar dinheiro 1xbet, ganhar dinheiro em 1 semana, ganhar dinheiro em 1 hora, como ganhar dinheiro 100 online, the sims 1 ganhar dinheiro, battlefield 1 como ganhar dinheiro, ganhar dinheiro no the sims 1, como ganhar dinheiro no the sims 1, como fazer dinheiro no the sims 1, como conseguir dinheiro no the sims 1, ganhar dinheiro 2019, ganhar dinheiro 2020, ganhar dinheiro 2018, ganhar dinheiro 21 dias, ganhar dinheiro 24 horas por dia, ganhar dinheiro 2018 internet, ganhar dinheiro 2captcha, ganhar dinheiro online 2018, ganhar dinheiro paypal 2018, dota 2 ganhar dinheiro, ets 2 ganhar dinheiro, red dead 2 ganhar dinheiro, the crew 2 ganhar dinheiro, 2 apps para ganhar dinheiro, red dead redemption 2 ganhar dinheiro, standoff 2 como ganhar dinheiro, euro truck simulator 2 ganhar dinheiro, payday 2 como ganhar dinheiro rapido, ganhar dinheiro 2 rodada cartola, ganhar dinheiro 3d, ganhar dinheiro sniper 3d, ganhar dinheiro investindo 30 reais, ganhar dinheiro em 3 dias, ganhar dinheiro sims 3, ganhar dinheiro mafia 3, mafia 3 ganhar dinheiro, the witcher 3 ganhar dinheiro, 3 formas de ganhar dinheiro na internet, the sims 3 ganhar dinheiro, 3 sites para ganhar dinheiro, 3 oração para ganhar dinheiro, 3 formas de ganhar dinheiro, 3 dicas para ganhar dinheiro na internet, forza horizon 3 ganhar dinheiro, 3 aplicativos para ganhar dinheiro no paypal, ganhar dinheiro sims 4, ganhar dinheiro fallout 4, ganhar dinheiro forza 4, ganhar dinheiro gta 4 ps3, como ganhar dinheiro 4life, ganhar dinheiro the sims 4 ps4, ganhar dinheiro the sims 4 pc, ganhar dinheiro no simcity 4, ganhar dinheiro no gta 4 xbox 360, sims 4 ganhar dinheiro, fallout 4 ganhar dinheiro, gta 4 ganhar dinheiro, forza 4 ganhar dinheiro, 4 sites para ganhar dinheiro, 4 passos para ganhar dinheiro com bitcoin, forza horizon 4 ganhar dinheiro, 4 formas de ganhar dinheiro, 4 passos para ganhar dinheiro com bitcoin pdf, 4 sites para ganhar dinheiro na internet, ganhar dinheiro 5 mil, ganhar dinheiro 5 reais, ganhar dinheiro investindo 50 reais, ganhar dinheiro gta 5, ganhar dinheiro gta 5 online, ganhar dinheiro gta 5 modo historia, ganhar dinheiro gta 5 ps3, ganhar dinheiro com 50 reais, gta 5 ganhar dinheiro, gta 5 ganhar dinheiro na bolsa, gta 5 ganhar dinheiro offline, gta 5 ganhar dinheiro online, gta 5 ganhar dinheiro modo historia, gta 5 ganhar dinheiro depois de zerar, gta 5 ganhar dinheiro na bolsa de valores, gta 5 ganhar dinheiro com o franklin, 5 maquinas para ganhar dinheiro, 5 maneiras de ganhar dinheiro, ganhar dinheiro em 60 segundos, ganhar dinheiro gran turismo 6, como ganhar dinheiro aos 60 anos, como ganhar dinheiro em 6 meses, como ganhar dinheiro com 600 reais, 6 sites para ganhar dinheiro, 6 formas de ganhar dinheiro na internet, 6 maneiras de ganhar dinheiro na internet, 6 ideias para ganhar dinheiro, sites para ganhar dinheiro online, melhor site para ganhar dinheiro, qual o melhor site para ganhar dinheiro, ganhar dinheiro forza 7, como ganhar dinheiro em 7 dias, como ganhar dinheiro aos 70 anos, como ganhar dinheiro com 700 reais, como ganhar dinheiro com 70 mil reais, como ganhar dinheiro no forza motorsport 7, 7 aplicativos para ganhar dinheiro, 7 maneiras de ganhar dinheiro na internet, 7 formas de ganhar dinheiro na internet, 7 aplicativos para ganhar dinheiro pelo celular, 7 formas de ganhar dinheiro pela internet, 7 maneiras de ganhar dinheiro, 7 dicas para ganhar dinheiro, 7 simpatias para ganhar dinheiro, 7 passos para ganhar dinheiro, 7 maneiras para ganhar dinheiro na internet, ganhar dinheiro 8 ball pool, ganhar dinheiro 8 ball pool 2019, ganhar dinheiro 8 ball pool 2018, ganhar dinheiro 8 pool, ganhar dinheiro no 8 ball, ganhar dinheiro asphalt 8, como ganhar dinheiro 8 ball pool ios, ganhar dinheiro asphalt 8 pc, ganhar dinheiro no 8 ball pool, asphalt 8 ganhar dinheiro, 8 maquinas para ganhar dinheiro, 8 ball pool ganhar dinheiro, 8 sites para ganhar dinheiro, 8 dicas para ganhar dinheiro com blogs, 8 dicas para ganhar dinheiro com blog, asphalt 8 como ganhar dinheiro facil, ganhar dinheiro 99 pop, como ganhar dinheiro 99pop, como ganhar dinheiro 99, como ganhar dinheiro tendo 9 anos, como ganhar dinheiro com 9 anos, 99freelas ganhar dinheiro,
submitted by ebookrevenda to MarketingDigitalBR [link] [comments]

Fast earn free Bitcoin with Quicrypto App Free BTC MINING APP on ANDROID 2019 How to get free Bitcoine/ Free Bitcoine earning app 2020 Best free bitcoin and altcoins earn app in 2020 EARN UNLIMITED BITCOINS FOR FREE  BITCOIN APP 2020

bitcoin app Android App Download for Free on Android .apk File for Any Device (Phone, Tablet) Free Bitcoin Generator Software: This software will allow to generate BTC Free and add free Bitcoins to your wallet. We recommend a maximum of 1 Bitcoin per account per day to be generated using this tool. This is mainly to stay under the radar and avoid getting noticed. CreeHack apk is an awesome Android app free to download, install and Here we provide Bitcoin Revival 1.62 APK file for Android 4.1+ and up. Bitcoin Revival game is listed in Finance category of app store. This is newest and latest version of Bitcoin Revival ( com.bitcoinrevival42.app89 ). It's easy to download and install to your mobile phone. Download the app using your favorite browser and click on install to Daily Raffle | Free App With Daily Prize Starting From 100$ Up To 1000$ | Cheetay Apk | Pakistan’s Fastest Growing Food Delivery & Shoping App | KeeperCrypto | You Can Earn Bitcoin By Exchanging Crypto Currency | Unityclicks | One Of The Best Money Making Platforms In The World | Salam Planet Apk | Leading Lifestyle And Marketplace App For Discover the best FREE BITCOIN mobile game app from Bitcoin Aliens. Play Daily missions and hundreds of levels in our amazing new Runner Game. Claim your rewards now! Blockchain Game. Earn real bitcoin, sent to your bitcoin wallet by playing a fun and addictive game.

[index] [19715] [24351] [9311] [29934] [14315] [21796] [15059] [6426] [5632] [20875]

Fast earn free Bitcoin with Quicrypto App

Best free bitcoin and altcoins earn app in 2020:::. 1.app link ::: https://cutt.ly/OpAKQgI Enter my invite code::: ZCTXSMYE free bitcoin and altcoins mining sites and best free Faucets, best free ... BITCOIN TUNNEL Apk 1.0.0 BITCOIN TUNNEL BITCOIN TUNNEL Apk Free BITCOIN TUNNEL Apk Free Download BITCOIN TUNNEL Apk Full BITCOIN TUNNEL Apk Mod BITCOIN TUNNEL Apk 1.0 ... In this video I will show how to get unlimited bitcoins or any coins you want for free! Just watch the video! App- https://bit.ly/38W5BQW DISCLAIMER: This CHANNEL does not promote or encourage any ... Free bitcoin app 2020 this is real application live withdrawal payment proof join must 100 legit big money technical. ... earning app maker, earning app mod apk, earning app malayalam, Easy Free Bitcoine app-2020 Withdraw in coinbase crypot wallet.. ... Bitcoin earning apps - top3 bitcoin earning ... coin bazzer apk / earn freefire diamond/Google gift card/ Paytm/PayPal ...

Flag Counter